Literature DB >> 21266090

A general scenario of Hox gene inventory variation among major sarcopterygian lineages.

Dan Liang1, Riga Wu, Jie Geng, Chaolin Wang, Peng Zhang.   

Abstract

BACKGROUND: Hox genes are known to play a key role in shaping the body plan of metazoans. Evolutionary dynamics of these genes is therefore essential in explaining patterns of evolutionary diversity. Among extant sarcopterygians comprising both lobe-finned fishes and tetrapods, our knowledge of the Hox genes and clusters has largely been restricted in several model organisms such as frogs, birds and mammals. Some evolutionary gaps still exist, especially for those groups with derived body morphology or occupying key positions on the tree of life, hindering our understanding of how Hox gene inventory varied along the sarcopterygian lineage.
RESULTS: We determined the Hox gene inventory for six sarcopterygian groups: lungfishes, caecilians, salamanders, snakes, turtles and crocodiles by comprehensive PCR survey and genome walking. Variable Hox genes in each of the six sarcopterygian group representatives, compared to the human Hox gene inventory, were further validated for their presence/absence by PCR survey in a number of related species representing a broad evolutionary coverage of the group. Turtles, crocodiles, birds and placental mammals possess the same 39 Hox genes. HoxD12 is absent in snakes, amphibians and probably lungfishes. HoxB13 is lost in frogs and caecilians. Lobe-finned fishes, amphibians and squamate reptiles possess HoxC3. HoxC1 is only present in caecilians and lobe-finned fishes. Similar to coelacanths, lungfishes also possess HoxA14, which is only found in lobe-finned fishes to date. Our Hox gene variation data favor the lungfish-tetrapod, turtle-archosaur and frog-salamander relationships and imply that the loss of HoxD12 is not directly related to digit reduction.
CONCLUSIONS: Our newly determined Hox inventory data provide a more complete scenario for evolutionary dynamics of Hox genes along the sarcopterygian lineage. Limbless, worm-like caecilians and snakes possess similar Hox gene inventories to animals with less derived body morphology, suggesting changes to their body morphology are likely due to other modifications rather than changes to Hox gene numbers. Furthermore, our results provide basis for future sequencing of the entire Hox clusters of these animals.

Entities:  

Mesh:

Substances:

Year:  2011        PMID: 21266090      PMCID: PMC3038165          DOI: 10.1186/1471-2148-11-25

Source DB:  PubMed          Journal:  BMC Evol Biol        ISSN: 1471-2148            Impact factor:   3.260


Background

The Hox genes are a large family of homeobox-containing transcription factors that control morphologies on the body axis of nearly all metazoans. Most of Hox genes normally consist of two exons with the conserved 180-bp homeobox located in exon2. In many animal species, Hox genes are arranged in genomic clusters with up to 15 distinct gene members [1] and, importantly, they are expressed in a "collinear fashion" -- anterior genes are expressed early in development and towards the front part of the embryo, posterior genes later in development and in more distal portions of the embryo [2]. Due to their important roles involved in patterning the anterior-posterior axis, modifications in Hox clusters might manifest in changes in the corresponding body regions; thus serve as a source of genetic innovations in shaping the diversification of metazoan body plans [3]. Because Hox genes are of particular interest in understanding the genetic basis of morphological evolution of metazoans, they are frequently among the first genes examined in an evolutionary context. Also Hox clusters have been characterized in a variety of animal species. Among chordates, the cephalochordate amphioxus possesses a single intact Hox gene cluster with 15 members [1]; in urochordate tunicates, the single cluster is secondarily broken and dispersed in the genome [4]. In contrast to these invertebrate chordates, primitive jawless vertebrates (lamprey and hagfish) possess three to seven Hox clusters, most probably through independent cluster duplications in the agnathan lineage [5-7]. Jawed vertebrates also have multiple clusters resulting from several rounds of genome-duplication events that occurred early in the evolution of vertebrates and some specific lineages. There are three or four clusters in chondrichthyans [8-10], four clusters in lobe-finned fishes [11-13] and tetrapods [14,15], up to eight in ray-finned fishes [16-20] and ~14 in tetraploid salmonid species [21]. The variations in vertebrate Hox clusters reflect a history of duplications and subsequent lineage-specific gene loss and can serve as models for studies of vertebrate genome evolution (reviewed by [14,22]). For the sarcopterygian lineage (lobe-finned fishes plus tetrapods), all of its members investigated to date bear four clusters (HoxA, HoxB, HoxC, and HoxD) but the number of gene members varies among different groups. Mammals possess 39 Hox genes. For birds, a recent report on genomic annotation of Hox clusters in chicken [23] deduced that birds may have the same Hox gene inventory to mammals but two genes (HoxC4 and HoxC5) are still missing due to the incompleteness of the chicken genome. In silico survey of frog (Xenopus tropicalis) [14] and lizard (Anolis carolinensis) [15] revealed the persistence of HoxC3 (lost in mammals) in both species, but two genes (HoxB13 and HoxD12) are thought to have been lost in anuran amphibians. Recent relevant studies have further reported that the absence of HoxB13 in frogs also occurs in caecilians, and the loss of HoxD12 in frogs also happens in salamanders, caecilians [24] and snakes [25]. Most recently, the complete Hox clusters of the Indonesian coelacanth (Latimeria menadoensis), an early-branching sarcopterygian, have been sequenced [13]. Compared to the tetrapod lineage, the coelacanth possesses 42 Hox genes in total, lacking HoxD13, but retaining the four genes (HoxC1, HoxC3, HoxB10, and HoxA14) which were secondarily lost in mammals. However, our knowledge of the Hox genes and clusters along the sarcopterygian lineage remains incomplete because data from some major groups are still missing (illustrated in Figure 1). For example, it is curious to see whether lungfishes possess Hox14 and lost HoxD13 in their genomes (available data is rather incomplete, see [11]) as coelacanths. On the other hand, a "snake-like" morphology (limblessness and elongated body) repeatedly occurs in different groups of amphibians and reptiles, such as snakes, caecilians and some legless lizards. There were published reports suggesting the "snake-like" body morphology may be due to altered expression of Hox genes [25-27]. Comparative analyses on the Hox clusters among these special groups should be able to provide further hints on how such expression alterations happen. For sequencing of the Hox clusters, a framework investigation of Hox gene inventory in these groups (snakes, caecilians, et al.) is needed.
Figure 1

Current status of the investigation of . We use a tritomy node for turtles, squamates (lizards and snakes) and archosaurs (birds and crocodiles), reflecting the current controversy on the relationships among them. Note that relevant information in most amphibian and reptile groups is either incomplete or missing.

Current status of the investigation of . We use a tritomy node for turtles, squamates (lizards and snakes) and archosaurs (birds and crocodiles), reflecting the current controversy on the relationships among them. Note that relevant information in most amphibian and reptile groups is either incomplete or missing. PCR surveys have demonstrated their value for preliminary identification of Hox genes in various animals [6,11,12,24]. However, PCR surveys of Hox genes often encounter a bias of the preference of degenerate primers and therefore, the actual number of existing genes is underestimated [6,24]. To circumvent this problem, we designed at least two sets of degenerated primers targeting a given Hox gene member, which increased the probability of successful amplification. Furthermore, when possible, we selected at least two species that span a broad evolutionary range for each tested groups, for which the primer preference may be different, maximizing the probability of finding all genes for a group. By adopting the two strategies, we carried out a comprehensive PCR survey for Hox genes in caecilians, salamanders, snakes, turtles, crocodiles, and lungfishes-the only other group of extant lobe-finned fishes beside coelacanths. We aimed to provide a more comprehensive understanding of Hox cluster evolution within the sarcopterygian lineage and present a general picture of Hox gene inventory variation among different sarcopterygian groups.

Results and Discussion

Amplification and Identification of Hox gene fragments

For each of the six sarcopterygian species examined, we tried different combinations of the degenerate primers, some targeted to several paralogue groups (PGs), some to specific groups and others to specific gene members, to amplify the homeobox-encoding region or exon1 of Hox genes (Table 1). We did several rounds of PCR first using "general" degenerate primers, and then using more specific primers designed for paralogue groups or gene members that were not found in the initial survey. A total of 3876 PCR fragments (80 to 165 bp long, depending on the primers used) were cloned and sequenced. Detailed information about the library construction and screening efficiency for the six sarcopterygian species and other relevant species is listed in the Additional file 1: Statistics of the sequenced clones. Occasionally, two sequences were found differing in only one to three nucleotides. When the nucleotide variations belong to synonymous substitutions and each of these sequences was present in more than one clone, they were considered as allelic variants. Conversely, non-synonymous substitutions of one or two nucleotides in only one clone but not the others of the same fragment were regarded as PCR or sequencing errors and excluded from further analyses.
Table 1

Primers used for amplification of Hox gene fragments

Target genePrimer nameSequence(5'-3')AA sequencesPL* (bp)Notes
Forward primers (located at homeobox region)
PG1-PG7HoxF1TNGARYTNGARAARGARTTYCALELEKEFH125universal for PG1-PG7
PG1-PG10HoxF1N1CARACNYTNGARYTNGARAARGARTTQTLELEKEF128universal for PG1-PG10
HoxF1N2CARGTNACNGARYTNGARAARGARTTQLTELEKEF128universal for PG1-PG10
PG5-PG7HoxF7SCARACNTAYACNMGNTAYCARACQTYTRYQT149universal for PG5-PG7
PG8-PG10HoxF8TNGARAARGARTTYYTNTTYAALEKEFLFN120universal for PG8-PG10
HoxF8NTNGARYTNGARAARGARTTYYTLELEKEFL125universal for PG8-PG10
PG9-PG11HoxF9DSNMGNAARAARVGNTGYCCNTATRKKRCPY164universal for PG9-PG11
PG1HoxF1SAAYTTYACNACNAARCARYTNACNFTTKQLT149universal for PG1
PG2HoxF2SMGGACNGCNTAYACNAAYACNCARTAYTNTQ152specific for PG2
PG3HoxF3SGCNTAYACNAGYGCNCARYTNGTAYTSAQLV149specific for PG3
HoxF3S1MGVCCNMGVMGVBTNGARATGGCRPRRVEMA80specific for PG3
PG4HoxF4SACNGCNTAYACNMGNCARCARGTTAYTRQQV152specific for PG4
PG5HoxF5SGGNAARMGSGCNMGSACNGCGKRARTA165specific for A5, B5
HoxFC5AARCGNTCYMGAACNAGYTAYACKRSRTSYT160specific for C5
PG8HoxF8SGARAARGARTTYYTNTTYAAYCCEKEFLFNP116specific for PG8
PG9HoxF9SGARAARGARTTYYTNTTYAAYATGEKEFLFNM116specific for PG9
PG10HoxF10SAARMGNTGYCCNTAYACNAARCAKRCPYTKH152specific for PG10
PG11HoxF11GARYTNGARMGNGARTTYTTYTTELEREFFF122specific for PG11
PG12HoxF12DSNMGNAARAARVGNAARCCNTASRKKRKPY164specific for PG12
HoxF12CAARCCNTAYTCNAARYTNCARATKPYSKLQL149specific for C12
HoxF12DAARCCNTAYACNAARCARCARATKPYTKQQI149specific for D12
HoxF12N1KCNMGVAARAARMGVAARCCSTASRKKRKPY164specific for PG12
HoxF12N2KCNMGVAARAARMGVAARCCWTASRKKRKPY164specific for PG12
HoxF12N3KCNMGVAARAARMGVAARACNTASRKKRKTY164specific for PG12
PG13HoxF13AGGNMGNAARAARMGNGTNCCNTAGRKKRVPY164specific for PG13(A,C,D)
HoxF13BGGNMGNAARAARMGNATHCCNTAGRKKRIPY164specific for PG13(B)
HoxF13A1CARYTRAARGARCTNGARMGNGARTAQLKELEREY128specific for PG13(A)
HoxF13B1CARYTRAARGARCTNGARAANGARTAQLKELENEY128specific for PG13(B,C,D)
Reverse primers (located at homeobox region)
PG1-PG12HoxR1TTCATNCKNCKRTTYTGRAACCAWFQNRRMK--universal for PG1-PG12
PG13HoxR13TTNACNCKNCKRTTYTGRAACCAWFQNRRVK--specific for PG13
PG14HoxR14TCNGGNGTNAGRAANCGRTTYTCENRFLTPE89specific for PG14, used with HoxF13A/HoxF13B
Primers used for amplification of exon1 of Hox genes
PG1HoxB1(5'E1)FGACATASTRYCNAAAGGTTGTAG5' UTR590-630forward primer for HoxB1
HoxB1(E1)RTTAACYTTCATCCANTCRAANGTTFDWMKVK--reverse primer for HoxB1
PG2Hox2S(E1)FGAATTYGAGMGRGARATHGGNTTEFEREIGF270-300forward primer for PG2
Hox2S(E1)RYTTYTTCTCYTTCATCCANGGPWMKEKK--reverse primer for PG2
PG3Hox3S(E1)FATGCARAAARCRRCNTAYTAYGAMQKATYYD400-480forward primer for PG3
HoxC3(E1)FATGCAAAARGSTCYYTAYTAYGAMQKGPYYE400-480forward primer for HoxC3
HoxA3(E1)FGCGACCTACTAYGAYAGYTCNGCATYYDSSA390-470forward primer for HoxA3
HoxD3(E1)FATGCAGAAARCNGCYTAYTAYGAMQKTAYYD400-480forward primer for HoxD3
Hox3S(E1)RTCYTTCATCCANGGRAADATNTGQIFPWMKE--reverse primer for PG3
PG6HoxB6(5'E1)FAWACTRCTAATAGCTAAASCRCT5' UTR480-510reverse primer for HoxB6
Hox6S(E1)RGARTTCATCCKYTGCATCCANGGPWMQRMNS--reverse primer for PG6
PG7HoxB7(5'E1)FCTCGTAAAACCGACACTAAAACG5' UTR440-460forward primer for HoxB7
Hox7S(E1)RCATCCARGGGTADATNCGRAAFRIYPWM--reverse primer for PG7

* PL: Product length.

Primers used for amplification of Hox gene fragments * PL: Product length. Initial BLAST searches in GenBank indicated that 82.9-96.5% sequenced clones belonged to Hox fragments, depending on the animal species examined. This result demonstrated the utility and efficiency of our newly designed Hox survey primers across most sarcopterygian lineages. Based on the phylogenetic analyses at the protein level, we can unambiguously assign 70-75% of the obtained homeobox sequences to exact Hox gene members. The phylogenetic signals in protein alignments of Hox2, Hox6-8 were especially weak so that the phylogenetic analyses at the nucleic acid level were performed to putatively distinguish Hox members for these paralogue groups. Using this strategy, we were able to determine the orthology of all obtained Hox fragments. To test the credibility of our assignment of putative Hox fragments based on the nucleic acid phylogenetic analyses, we chose two species (Naja atra and Ichthyophis bannanicus) to perform the TAIL-PCR-based genome walking to get the 3' flanking sequences of their putative Hox6-8 fragments. The newly obtained sequences were compared with known sarcopterygian Hox genes, and all the assignments were verified.

Hox gene inventories of different animal groups

Lungfishes

Protopterus annectens, the African lungfish, was found to have a total of 42 Hox genes orthologous to genes of the four coelacanth Hox clusters. Generally the Hox inventory of the African lungfish is quite similar to that of the coelacanth (Latimeria menadoensis) [13], for example, they both possess HoxC1, HoxC3 and HoxB10; but interestingly the African lungfish lacks HoxD12 while the coelacanth has no HoxD13. Moreover, because the coelacanth has a HoxA14 gene and chondrichthyans have a HoxD14 gene [9,10] but all tetrapod species examined so far lack Hox-14, we wonder if Hox14 member also exist in lungfishes and/or the basal tetrapod lineage, i.e. caecilians. To this end, an 84-bp-fragment conserved only in Hox14 was tested by PCR in the African lungfish and the Banna caecilian and only the African lungfish gave the band with expected size, suggesting that Hox14 may have been lost in all tetrapods. However, no further assignment could be made for the lungfish Hox14 fragment because of its short size. We thus performed genome walking towards both ends of this Hox14 fragment and got full sequence of the exon2 of the lungfish Hox14. Using the lamprey Hox14 alpha as outgroup, phylogenetic analysis unambiguously assigned the lungfish's Hox14 member as a HoxA14 (Figure 2). Among all vertebrates investigated to date, only the coelacanths and the lungfishes which represent the only two groups of the extant lobe-finned fish possess HoxA14. Thus, HoxA14 seems to be characteristic of the lobe-finned fish Hox repertoire.
Figure 2

Characterization of the exon2 of the lungfish . (a) Neighbor-joining tree inferred from deduced protein sequences of the exon2 of Hox14 gene with JTT distance. Exon2 of Hox14 from lungfish (Protopterus annectens), coelacanth (Latimeria menadoensis), elephant shark (Callorhinchus milii) and horn shark (Heterodontus francisci) are included and the lamprey (Lethenteron japonicum) Hox14 alpha is used to root the tree. Bootstrap supports are given for each node above branches. (b) Protein alignment of Hox14 exon2 from the five species. Residues that are conserved in all species are indicated with asterisks below the alignment and that are diagnostic for HoxA14 or HoxD14 are highlighted with pink or yellow shading respectively.

Characterization of the exon2 of the lungfish . (a) Neighbor-joining tree inferred from deduced protein sequences of the exon2 of Hox14 gene with JTT distance. Exon2 of Hox14 from lungfish (Protopterus annectens), coelacanth (Latimeria menadoensis), elephant shark (Callorhinchus milii) and horn shark (Heterodontus francisci) are included and the lamprey (Lethenteron japonicum) Hox14 alpha is used to root the tree. Bootstrap supports are given for each node above branches. (b) Protein alignment of Hox14 exon2 from the five species. Residues that are conserved in all species are indicated with asterisks below the alignment and that are diagnostic for HoxA14 or HoxD14 are highlighted with pink or yellow shading respectively.

Caecilians

In the Banna caecilian (Ichthyophis bannanicus) 39 unique Hox gene fragments were found. Besides the core set of Hox genes (using mammals' as reference), we identified a HoxC1 fragment as well as a HoxC3 fragment in the Banna caecilian. The presence of HoxC1 in caecilians was further validated by screening the Hox1 library (see the Additional file 1: Statistics of the sequenced clones) in Gymnopis multiplicata, a representative of derived caecilians. Because HoxC3 was also found in the frog (Xenopus tropicalis; [15]) and the salamander (our survey, see below), it seems that all living amphibians retain HoxC3. Therefore we did not perform further survey for HoxC3 in other caecilian species. In addition, after having tried different combinations of primers, we could not find fragments of HoxD12 and HoxB13 in the three tested caecilian species (I. bannanicus, G. multiplicata, and Typhlonectes natans; see the Additional file 1: Statistics of the sequenced clones) which is consistent with the loss of HoxD12 and HoxB13 in caecilians previously reported by Mannaert et al. [24].

Salamanders

Compared with other animal groups, surveying the Hox gene inventory for salamanders was more difficult. We tried several species but in none of them could we find more than thirty-three Hox genes. In order to give a more integrated Hox gene inventory of salamanders, we combined the results from two species (Batrachuperus tibetanus and Pachytriton brevipes) to represent the group. Initial PCR survey of homeobox fragments in Batrachuperus tibetanus, the Tibetan mountain salamander, identified 33 Hox gene fragments after sequencing over 770 clones. Compared with the frog Hox complement, HoxA1, HoxA3, HoxD3, HoxB6, HoxB7 and HoxA10 were missing. The missing Hox genes were further surveyed in another salamander Pachytriton brevipes and two more Hox members (HoxA1 and HoxA10) were detected after sequencing 220 clones. To validate the potential presence of the remaining Hox members, we turned to detect their respective exon1s and finally fragments of HoxA3, HoxD3, HoxB6 and HoxB7 were found. Consistent with the previous reports of the presence of HoxB13 in salamandrids [24] and ambystomatids [Genbank: AF298184], we identified HoxB13 in the more basal hynobiid salamander (B. tibetanus), suggesting the presence of HoxB13 is likely a universal feature of all salamanders. Likewise, we did not detect HoxD12 in all salamanders investigated (see the Additional file 1: Statistics of the sequenced clones), in accordance with the previous survey result [24]. Altogether, salamanders have 39 Hox genes with the presence of HoxC3 and absence of HoxD12 and unlike the other two amphibian groups, salamanders possess HoxB13.

Frogs

The genomic architecture of Hox clusters of the frog (Xenopus tropicalis, a diploid frog species) has been previously reported [15] but HoxB7 was not detected in its genome due to a sequencing gap. However, HoxB7 mRNA was cloned in another frog (Xenopus laevis; accession: NM_001085641), indicating that frogs possess HoxB7 gene. In total, frogs have 38 Hox genes, lacking HoxB13 and HoxD12, but retaining HoxC3.

Lizards and Snakes

Di-Poï et al. [15] analyzed the genome data of the green anole lizard (Anolis carolinensis) and reported that lizards have 40 Hox gene with an additional HoxC3 gene which is absent in mammals. However, HoxB13 and HoxD9 were only deduced genes in their study, not directly detected due to some sequencing gaps. We reanalyzed the flanking sequences of these gaps and identified fragments orthologous to HoxB13 (exon2) and HoxD9 (exon1), improving the completeness of lizards' Hox gene inventory. For snakes, we found 39 unique Hox sequences in the Chinese cobra (Naja atra). Like lizards, snakes also have a HoxC3 gene. To see if the presence of HoxC3 is a characteristic of all squamates, we further surveyed the Hox-3 genes in two other squamate species: gecko (Hemidactylus bowringii) and blind skink (Dibamus bourreti), belonging to two basal squamate groups Gekkonidae and Dibamidae, respectively. As a result, fragments of HoxC3 were unambiguously identified in the two species (see the Additional file 1: Statistics of the sequenced clones), suggesting all squamates should possess HoxC3. Despite HoxD12 having been annotated in the green anole lizard, we did not detect HoxD12 fragment in the Chinese cobra after screening the Hox12 libraries constructed with different primer pairs. Absence of HoxD12 has just been reported in the corn snake recently [25]. Since both the Chinese cobra and the corn snake belong to derived snakes, to further test if HoxD12 is absent in all snakes, we surveyed Hox12 in two other snakes: blind snake (Leptotyphlops blanfordii) and ball python (Python regius) which occupy more basal positions on the Serpentes tree and might be able to circumvent the Hox12-specific primer bias if there were any. As a result, only HoxC12 fragment could be found in these two snakes as well (see the Additional file 1: Statistics of the sequenced clones). Therefore, it is likely that snakes have lost HoxD12.

Turtles

Pelodiscus sinensis, which is also known as the Chinese soft-shell turtle, was found to have 39 Hox genes, lacking HoxC3 compared with lizards. Since the squamate reptiles investigated so far have retained HoxC3, we wondered if the missing of HoxC3 in turtles was due to primer bias. So we surveyed Hox3 genes in another four turtles: the yellow-spotted Amazon river turtle (Podocnemis unifilis), the pig-nosed turtle (Carettochelys insculpta), the painted turtle (Chrysemys picta) and the red-eared slider turtle (Trachemys scripta), which were particularly selected to represent a broad evolutionary coverage for turtles. As a result, no fragments of HoxC3 could be identified (see the Additional file 1: Statistics of the sequenced clones), which is consistent with the loss of HoxC3 in turtles.

Crocodiles

For the Siamese crocodile (Crocodylus siamensis), most Hox genes were found as expected using the chicken Hox gene inventory [23] as reference. However, only one homeobox fragment was retrieved for Hox2 which usually contains two members (HoxA2 and HoxB2) though several primer combinations have been tried. Because the loss of HoxA2 or HoxB2 has never been reported in other vertebrates, we used primers targeting exon1 for HoxA2 and HoxB2 and were able to identify specific fragments for both genes in the Siamese crocodile. In addition, HoxC3 was not detected in the Siamese crocodile and its absence in crocodiles was further validated in the Chinese alligator (Alligator sinensis; see the Additional file 1: Statistics of the sequenced clones), a representative of the other major clade of living crocodiles. Thus crocodiles have 39 Hox genes and their Hox gene inventory is the same as that of mammals.

Birds

Though the genomic annotation of Hox clusters has been reported for the chicken (Gallus gallus), information for HoxC4 and HoxC5 is still missing due to incomplete genomic assembly [15,23]. And because of the gap at the 3' end of the HoxC cluster in the chicken genome, we do not know whether chicken has HoxC3 or not. Besides, we found the homeobox of the predicted chicken HoxC12 [Genbank: XM_426957] differs a lot from its orthologs in other vertebrates and may have assembly errors. In our PCR survey we confirmed the presence of chicken HoxC4 and HoxC5 by finding their respective homeobox fragments. To test whether birds retain HoxC3, we surveyed Hox3 genes in two birds: the domestic duck (Anas platyrhynchos var. domestica) and the ostrich (Struthio camelus), representing two major bird lineages (Neognathae and Paleognathae) respectively. As a result, HoxC3 was not detected, suggesting it was lost in birds (see the Additional file 1: Statistics of the sequenced clones). The reexamination of Hox12 in chicken, duck and ostrich confirmed the presence of HoxD12 in birds and revealed a fragment appearing well conserved with HoxC12s in other vertebrates, which, we think, represents the true bird HoxC12 (see the Additional file 1: Statistics of the sequenced clones). Hence, with the detection of HoxC4, HoxC5, HoxC12 and HoxD12 in birds, our data provides a more complete picture of avian Hox gene inventory.

Mammals

Although the Hox gene inventory for placental mammals (e.g., human and mouse) is clear, the relevant information for the other two major groups of extant mammals: marsupials, monotremes, has not been reported yet. We therefore performed an in silico survey of Hox genes for the grey short-tailed opossum Monodelphis domestica (version Broad/monDom5; URL: http://genome.ucsc.edu/cgi-bin/hgGateway?org=Opossum) and the duck-billed platypus Ornithorhynchus anatinus (version WUGSC 5.0.1/ornAna1; URL: http://genome.ucsc.edu/cgi-bin/hgGateway?org=Platypus). In both species, the Hox A, B, and D clusters are almost identical to those in human (HoxB6 was not detected in the platypus due to a sequencing gap). For the HoxC cluster, the platypus lacks genomic sequences covering HoxC5, HoxC4 and its 3' flanking region; the opossum lacks almost the entire genomic sequences of the HoxC cluster, except fragments of HoxC6 and HoxC9. Based on the observation that the architecture of HoxC13-C4 is conserved among all tetrapods, it is tempting to infer that marsupials and monotremes possess the same HoxC members as well. However, because the genomic sequences of the 3' flanking region of HoxC4 in both the opossum and the platypus are still missing, it would be premature to derive any conclusions about the presence/absence of HoxC3 in marsupials and monotremes.

The general scenario

Combining our data with other published data, we are now able to provide a more complete scenario of how Hox gene inventory variation occurs along major sarcopterygian lineages, from lobe-finned fishes to mammals (Figure 3). On the whole, the four-cluster Hox architecture is well conserved; relatively basal lineages tend to retain more Hox gene members. The HoxA14, B10, C1, C3 were consecutively lost during the process of sarcopterygian evolution. HoxD12 and HoxB13 seem to be two hotspots of gene loss and different animal groups may have lost these Hox genes independently.
Figure 3

Reconstructed evolutionary history of . Colored squares indicate Hox genes that have been identified; white squares are Hox genes that have not yet been sequenced but probably are present in the cluster(s). Solid lines connecting gene boxes indicate physical genomic linkage. Genomic sequences flanking HoxC3 gene in both opossum and platypus are still missing thus we consider the presence/absence of HoxC3 in marsupial and monotreme mammals is unknown yet (indicated by question marks). The gene inventory of the Hox clusters in the hypothetical ancestors of major evolutionary lineages are inferred based on parsimony principles, shown in open boxes above branches. Secondary losses of Hox genes are indicated in orange boxes along branches. A currently accepted phylogenetic tree is shown on the left, with divergence times (taken from [51]) shown beside nodes. Note that we tentatively favor a turtle-archosaur relationship based on HoxC3 variation among different amniote groups (see text for detailed discussion).

Reconstructed evolutionary history of . Colored squares indicate Hox genes that have been identified; white squares are Hox genes that have not yet been sequenced but probably are present in the cluster(s). Solid lines connecting gene boxes indicate physical genomic linkage. Genomic sequences flanking HoxC3 gene in both opossum and platypus are still missing thus we consider the presence/absence of HoxC3 in marsupial and monotreme mammals is unknown yet (indicated by question marks). The gene inventory of the Hox clusters in the hypothetical ancestors of major evolutionary lineages are inferred based on parsimony principles, shown in open boxes above branches. Secondary losses of Hox genes are indicated in orange boxes along branches. A currently accepted phylogenetic tree is shown on the left, with divergence times (taken from [51]) shown beside nodes. Note that we tentatively favor a turtle-archosaur relationship based on HoxC3 variation among different amniote groups (see text for detailed discussion).

Hox gene variation among sarcopterygian lineages and its evolutionary implications

The loss of HoxD12 is not directly related to digit reduction

Mannaert et al. [24] have proposed the absence of HoxD12 in amphibians be related to the absence of the fifth finger as frogs and salamanders normally have only four fingers and caecilian is limbless. In such a view, HoxD12 would be frequently lost in limbless animals (no digits at all). The hypothesis seems reasonable because HoxD12 does be lost in the snake (limbless, no digits) and the African lungfish (only with thread-like fins) according to our Hox gene survey. However, besides snakes, there are many other squamates with snake-like, limbless body forms. It is necessary to test the hypothesis more strictly in these limbless animals as well. To this end, we further surveyed Hox12 genes in other limbless lizards, such as Amphisbaena caeca (Amphisbaenidae), Blanus strauchi (Blanidae), Ophisaurus harti (Anguidae), Anniella pulchra (Anniellidae), Typhlosaurus sp. (Scincidae) and Dibamus bourreti (Dibamidae), representing a broad evolutionary coverage for squamates. To our surprise, both HoxC12 and D12 could be unambiguously detected in all these limbless animals (see the Additional file 1: Statistics of the sequenced clones). This result indicated that the loss of HoxD12 is not as directly related to the digit-reduction phenotype as previously proposed.

The significance of HoxD13 retention in lungfishes

While the other group of extant lobe-finned fish, the coelacanths, has lost HoxD13 [13], a HoxD13 fragment was identified from the African lungfish in our PCR survey. Previous knock-out experiments in mice have demonstrated that HoxD13 is essential in the autopodium formation for tetrapods [28,29], so it is easy to understand the fact that all tetrapods investigated so far possess the HoxD13 gene. Therefore, the retention of HoxD13 which is shared by tetrapods and lungfishes but not coelacanths, is consistent with lungfishes being the closest living sistergroup of tetrapods, a widely accepted relationship among coelacanths, lungfishes and tetrapods [30]. Strictly, small Hox gene fragments generated by PCR surveys are not definite evidences for the absence/presence of a gene, for example, the HoxD13 fragment in the goldfish Carassius auratus auratus is thought to represent a pseudo gene [31]. Therefore, we wonder whether the African lungfish HoxD13 is really a functional gene. To address this issue, genome walking was performed to obtain the 5' region of the homeobox of the lungfish HoxD13, including the intron and the complete exon1. No premature stop codons were observed, indicating the African lungfish HoxD13 is not a pseudo gene. Sequence alignments and phylogenetic analysis show that, the tetrapod HoxD13s are more similar to the African lungfish HoxD13 than to that of bony fishes (zebrafish) or cartilaginous fishes (shark) (Figure 4). Although the lungfish has no "digits", its HoxD13 may represent the intermediate form towards the functions in tetrapod HoxD13s during the fin-to-limb transitional history. In the future it would be interesting to perform "replacement" experiments in mice to see to what extent the lungfish HoxD13 could rescue the functions of the tetrapod HoxD13 especially in terms of autopodium formation.
Figure 4

Comparison of vertebrate HoxD13 protein sequences. (a) Diagram of the structure of HoxD13 gene. The HoxD13 gene comprises two exons (shown as open boxes), and the homeobox region locates in the exon2 (indicated by dash line frame). (b) Partial protein alignment of HoxD13 (shaded region in Figure 4a) from human (Homo sapiens), mouse (Mus musculus), chicken (Gallus gallus), frog (Xenopus tropicalis), lungfish (Protopterus annectens), elephant shark (Callorhinchus milii) and zebrafish (Danio rerio). Exon-intron splicing site is indicated as black triangle and the homeobox region is shown in a dash line frame. (c) Neighbor-joining tree (JTT distance) inferred from the above protein alignment with bootstrap supports of 1,000 iterations.

Comparison of vertebrate HoxD13 protein sequences. (a) Diagram of the structure of HoxD13 gene. The HoxD13 gene comprises two exons (shown as open boxes), and the homeobox region locates in the exon2 (indicated by dash line frame). (b) Partial protein alignment of HoxD13 (shaded region in Figure 4a) from human (Homo sapiens), mouse (Mus musculus), chicken (Gallus gallus), frog (Xenopus tropicalis), lungfish (Protopterus annectens), elephant shark (Callorhinchus milii) and zebrafish (Danio rerio). Exon-intron splicing site is indicated as black triangle and the homeobox region is shown in a dash line frame. (c) Neighbor-joining tree (JTT distance) inferred from the above protein alignment with bootstrap supports of 1,000 iterations.

The variation of HoxC3 shows clues for turtles' position on the amniote tree

The phylogenetic position of turtles is the most controversial issue in the reconstruction of the living amniote tree of life. After many different kinds of investigations from both molecular and morphological data, four main hypotheses concerning the phylogenetic relationships of turtles to the other groups of living amniotes have been proposed [30]: (A) Turtles as the only living representatives of anapsid reptiles, and as the sister-group of diapsid reptiles, i.e., the Lepidosauria (the tuatara, snakes, and lizards) + Archosauria (crocodiles and birds); (B) Turtles placed within diapsids, and as the sister-group of the Lepidosauria; (C) Turtles as diapsids, and as the sister-group of the Archosauria; (D) Turtles as diapsids, but placed inside the Archosauria, and as the sister-group of crocodiles. Most morphological studies favor either Hypothesis A [32-35] or B [36,37] and Hypothesis A is the traditional view of the placement of turtles. In contrast to morphological views, recent molecular phylogenetic studies tend to support either Hypotheses C or D and reject Hypotheses A and B [38-43]. However, due to a severe slow down of substitution rate in turtles relative to diapsid reptiles [43], we can not rule out the possibility that the molecular turtle-archosaur relationship is caused by analytical artifacts. Therefore, besides traditional morphological inferences and sequence-based molecular phylogenetic analyses, a third form of data is needed to explore and test the alternative phylogenetic hypotheses of the turtle's placement. The presence of HoxC3 gene among living amniote lineages seems a good indicator of their interrelationships. Since both lobe-finned fishes and amphibians possess HoxC3, the presence of HoxC3 is most likely the ancestral state for amniotes. According to our survey, for living amniotes, only squamates (snakes and lizards) retained HoxC3 (the tuatara data is missing here, but it will not alter our inference due to its affinity to squamates) and other groups (mammals, birds, crocodiles and turtles) all lost this gene. Following the principle of Dollo parsimony - which assumes that losses of genes are much more common and likely than independent evolutionary origins, - we can evaluate the four hypotheses about the position of turtles mentioned above. Both Hypotheses A and B require 3 steps of independent loss of HoxC3 in mammals, turtles and archosaurs while Hypotheses C and D need only two steps. Consequently, our Hox gene inventory data is in line with most recent molecular studies favoring a turtle-archosaur relationship but unable to discriminate between Hypotheses C and D. Considering that Archosauria is a well supported clade, we tentatively accept Hypothesis C and illustrate turtles' position as shown in Figure 3.

The retention of HoxC1 in caecilians supports the Batrachia hypothesis

Because sharks, many teleost fishes, lobe-finned fishes all possess HoxC1 but all tetrapod species examined before this study lack this gene, Kuraku and Meyer [22] deduced that tetrapod ancestors lost their HoxC1 gene when they diverged from lobe-finned fishes. However, our finding of HoxC1 in caecilians suggested that tetrapod ancestors actually retained HoxC1 gene but subsequently lost in different lineages. The presence of HoxC1 likely represents a "fish-style" Hox gene inventory and only basal tetrapod lineages have the possibility to retain this gene. Amphibians definitely branch first from the tetrapod tree and comprise of three distinct living groups: frogs, salamanders and caecilians [44]. The retention of HoxC1 in caecilians but not in frogs and salamanders implied that among the three living amphibian groups, caecilians are more distantly related to frogs and salamanders, supporting the Batrachia hypothesis (a frog+salamander clade) advocated by most recent molecular studies [45-48].

Conclusions

We performed a comprehensive PCR survey of Hox genes for six major sarcopterygian groups: lungfishes, caecilians, salamanders, snakes, turtles and crocodiles and clarified some uncertainties of birds' Hox gene inventory. Our study provided a more complete scenario for evolutionary dynamics of Hox genes along major sarcopterygian lineages. On the whole, Hox gene inventories of sarcopterygians are rather conserved with only little variations occurring in the anterior or posterior Hox paralogue groups. The Hox gene inventories of limbless caecilians and snakes largely resemble those of animals with less derived body morphology, suggesting changes to their body morphology were likely due to other modifications rather than changes to Hox gene numbers. In future, it is interesting to sequence the entire Hox clusters for these animals and our work can serve as basis for this purpose.

Methods

Taxon sampling

In order to obtain a broad overview of Hox gene variation in major sarcopterygian lineages, we focused on those groups whose Hox gene data were incomplete or missing when our research began. The following six species were selected for comprehensive Hox gene survey: Protopterus annectens (African lungfish) which represents another major group of extant lobe-finned fishes besides coelacanths; Ichthyophis bannanicus (Banna caecilian) and Batrachuperus tibetanus (Tibetan mountain salamander) representing caecilians and salamanders for the amphibian lineage; Naja atra (Chinese cobra), Pelodiscus sinensis (Chinese soft-shell turtle) and Crocodylus siamensis (Siamese crocodile) as the representative of snakes, turtles and crocodiles for the reptilian lineage, respectively. As we found some Hox gene variations among these group representatives, we selected additional 22 species, providing a broad evolutionary coverage for different animal groups, to test the observed Hox variation within certain group. Detailed information for all species used in this study is listed in Table 2.
Table 2

List of species used in this study

TaxonomyScientific nameCommon nameCollection locality (or specimen voucher No.)
Species used for PCR survey
SarcopterygiiDipnoiProtopterus annectensAfrican lungfishPet trade
AmphibiaGymnophionaIchthyophis bannanicus*Banna caecilianBeiliu, Guangxi, China
CaudataBatrachuperus tibetanusTibetan mountain salamanderQingchuan, Sichuan, China
ReptiliaSerpentesNaja atra*Chinese cobraShaoguan, Guangdong, China
TestudinesPelodiscus sinensisChinese softshell turtleShaoguan, Guangdong, China
CrocodyliaCrocodylus siamensisSiamese crocodileShenzhen, Guangdong, China
Species used for Hox gene member validation
GymnophionaCaeciliidaeGymnopis multiplicata*Purple caecilianMVZ Herps 228795
TyphlonectidaeTyphlonectes natans*Rubber eelMVZ Herps 179733
CaudataSalamandridaePachytriton brevipesChinese fat newtAnji, Zhejiang, China
HynobiidaeBatrachuperus yenyuanensisYenyuan stream salamanderXichang, Sichuan, China
SerpentesPythonidaePython regius*Ball pythonPersonal captivity
LeptotyphlopidaeLeptotyphlops blanfordii*Blind snakeMVZ Herps 236621
SquamataDibamidaeDibamus bourreti*Bourret's blind skinkHongkong, China
GekkonidaeHemidactylus bowringiiHouse GeckoGuangzhou, Guangdong, China
AnguidaeOphisaurus harti*Hart's glass lizardPet trade
ScincidaeTyphlosaurus sp. *Legless skinkMVZ Herps 164850
BlanidaeBlanus strauchi*Anatolian worm lizardMVZ Herps 230227
AmphisbaenidaeAmphisbaena caeca*Puerto Rican worm lizardMVZ Herps 232753
AnniellidaeAnniella pulchra*California legless lizardMVZ Herps 230670
BipedidaeBipes biporusBaja worm lizardMVZ Herps 236257
TestudinesPodocnemididaePodocnemis unifilisYellow-spotted Amazon river turtlePet trade
CarettochelyidaeCarettochelys insculptaPig-nosed turtlePet trade
EmydidaeChrysemys pictaPainted turtleMVZ Herps 241506
Trachemys scriptaRed-eared slider turtleCommercial food source
CrocodyliaAlligatoridaeAlligator sinensisChinese alligatorAlligator Research Center, Xuanzhou, Anhui, China
AvesPaleognathaeStruthio camelusOstrichCommercial food source
GalliformesGallus gallus domesticusChickenCommercial food source
AnseriformesAnas platyrhynchos var. domesticaDomestic duckCommercial food source

* Species that is limbless or only has limb remnants

List of species used in this study * Species that is limbless or only has limb remnants

PCR, cloning and sequencing of Hox genes

We amplified fragments of Hox genes from genomic DNA by PCR using several combinations of degenerate primers flanking the homeobox or exon1 region (Table 1). In the comprehensive surveys for the group representatives, Hox genes were first divided into six paralogue group (PG) sets (PG1-7, PG1-10, PG11, PG12, PG13, PG14) for amplification. For some paralogue groups such as PG12 and PG13 which were difficult to amplify, more than one set of primers was used to increase the probability of successful amplification. If any members of PG1-10 was not initially retrieved with the general primers, e.g., HoxC5 of PG5 could not been found, a PG specific forward primer HoxF5S would be used; if the PG specific primers still failed to amplify the gene, a more specific primer HoxFC5 would be used to confirm its presence or absence. PG specific primers were also applied in the subsequent confirmation of Hox gene variations in the additional 22 species. We know that non-detection by PCR survey can not be interpreted definitively as a missing gene, but by trying more sets of primers and surveying more numbers of related species, the completeness of Hox gene PCR survey for a given animal group is expected to be high. PCR was performed in 25 μl reaction volumes with ExTaq DNA polymerase (Takara, Dalian) using the following cycling parameters: an initial denaturation step at 94°C for 4min, 45 cycles of 94°C for 30s, 42-55°C for 1min, 72°C for 30s, and a final extension step at 72°C for 10min. PCR products were purified by agarose gel extraction (Axygen, Suzhou) and cloned into a PMD19-T vector (Takara, Dalian). Positive recombinant clones were identified by colony PCR and the PCR products were cleaned with ExoSap treatment and sequenced on an automated ABI3730 DNA sequencer.

Sequence analysis

Firstly, an alignment of homeobox regions of Hox genes from six well-studied vertebrate species was made. Hox genes of coelacanth (Latimeria menadoensis), frog (Xenopus tropicalis), chicken (Gallus gallus), lizard (Anolis carolinensis), mouse (Mus musculus) and human (Homo sapiens) were retrieved from GenBank upon availability. For some Hox genes of frog, lizard and chicken that can not be directly collected from GenBank, we identified their draft sequences by alignments with other vertebrates at the UCSC Genome Browser http://genome.ucsc.edu/. All the obtained sequences were cut down to 180 bp of homeobox and aligned by ClustalX [49]. For each of the examined species, we compared all its obtained sequences against each other and identified a set of unique sequences for the species. These unique sequences were first screened for Hox gene fragments using BLAST searches in GenBank. Candidate sequences were then aligned to the aforementioned 6-species homeobox alignment, both at the protein and the nucleic acid level. Phylogenetic trees were generated by the Neighbor-Joining method implemented in the MEGA 4.0 [50] with either K2P (for nucleic acid) or JTT (for protein) distances. Supports for the nodes were evaluated by non-parametric bootstrap analyses of 1,000 replicates. The assignment of the candidate sequences were made based on their phylogenetic position at the protein or the nucleic acid level.

Genome walking

Because the homeobox regions we used are relatively short, some Hox gene fragments cannot be undoubtedly assigned to certain paralogue. To confirm the credibility of our assignments, we performed genome walking (GW) to obtain the unknown sequence adjacent to the homeobox region towards 5' or 3' end of exon2. The homeobox-flanking regions are less conserved and more informative and thus can facilitate identification of the paralogue. The genome walking was carried out by using the Genome Walking Kit (Takara, Dalian) which is based on a TAIL-PCR technique. GW-specific primers were designed based on the candidate fragment sequences following the manufacture's guidance (available upon request).

Sequence availability

All sequences of Hox gene fragments identified in this paper are deposited in GenBank under accession numbers HQ441256 to HQ441561

Authors' contributions

DL and PZ conceived the study. PZ designed the experiments. RW and JG carried out the PCR survey and the genome walking experiments. DL, PZ and RW analyzed the data. CW provided the alligator sample. DL, PZ and RW wrote the manuscript. All authors read and approved the final manuscript.

Additional file 1

Statistics of clones sequenced in each species and during the validation of . Click here for file
  42 in total

1.  On the origin of and phylogenetic relationships among living amphibians.

Authors:  R Zardoya; A Meyer
Journal:  Proc Natl Acad Sci U S A       Date:  2001-06-05       Impact factor: 11.205

Review 2.  Organizing axes in time and space; 25 years of colinear tinkering.

Authors:  Marie Kmita; Denis Duboule
Journal:  Science       Date:  2003-07-18       Impact factor: 47.728

3.  Disruption of the Hoxd-13 gene induces localized heterochrony leading to mice with neotenic limbs.

Authors:  P Dollé; A Dierich; M LeMeur; T Schimmang; B Schuhbaur; P Chambon; D Duboule
Journal:  Cell       Date:  1993-11-05       Impact factor: 41.582

4.  CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice.

Authors:  J D Thompson; D G Higgins; T J Gibson
Journal:  Nucleic Acids Res       Date:  1994-11-11       Impact factor: 16.971

5.  Genome duplication in the teleost fish Tetraodon nigroviridis reveals the early vertebrate proto-karyotype.

Authors:  Olivier Jaillon; Jean-Marc Aury; Frédéric Brunet; Jean-Louis Petit; Nicole Stange-Thomann; Evan Mauceli; Laurence Bouneau; Cécile Fischer; Catherine Ozouf-Costaz; Alain Bernot; Sophie Nicaud; David Jaffe; Sheila Fisher; Georges Lutfalla; Carole Dossat; Béatrice Segurens; Corinne Dasilva; Marcel Salanoubat; Michael Levy; Nathalie Boudet; Sergi Castellano; Véronique Anthouard; Claire Jubin; Vanina Castelli; Michael Katinka; Benoît Vacherie; Christian Biémont; Zineb Skalli; Laurence Cattolico; Julie Poulain; Véronique De Berardinis; Corinne Cruaud; Simone Duprat; Philippe Brottier; Jean-Pierre Coutanceau; Jérôme Gouzy; Genis Parra; Guillaume Lardier; Charles Chapple; Kevin J McKernan; Paul McEwan; Stephanie Bosak; Manolis Kellis; Jean-Nicolas Volff; Roderic Guigó; Michael C Zody; Jill Mesirov; Kerstin Lindblad-Toh; Bruce Birren; Chad Nusbaum; Daniel Kahn; Marc Robinson-Rechavi; Vincent Laudet; Vincent Schachter; Francis Quétier; William Saurin; Claude Scarpelli; Patrick Wincker; Eric S Lander; Jean Weissenbach; Hugues Roest Crollius
Journal:  Nature       Date:  2004-10-21       Impact factor: 49.962

6.  Genomic analysis of Hox clusters in the sea lamprey Petromyzon marinus.

Authors:  Steven Q Irvine; Janet L Carr; Wendy J Bailey; Kazuhiko Kawasaki; Nobuyoshi Shimizu; Chris T Amemiya; Frank H Ruddle
Journal:  J Exp Zool       Date:  2002-04-15

7.  Independent Hox-cluster duplications in lampreys.

Authors:  Claudia Fried; Sonja J Prohaska; Peter F Stadler
Journal:  J Exp Zool B Mol Dev Evol       Date:  2003-10-15       Impact factor: 2.656

8.  Molecular systematics of primary reptilian lineages and the tuatara mitochondrial genome.

Authors:  Joshua S Rest; Jennifer C Ast; Christopher C Austin; Peter J Waddell; Elizabeth A Tibbetts; Jennifer M Hay; David P Mindell
Journal:  Mol Phylogenet Evol       Date:  2003-11       Impact factor: 4.286

9.  Evidence for independent Hox gene duplications in the hagfish lineage: a PCR-based gene inventory of Eptatretus stoutii.

Authors:  Peter F Stadler; Claudia Fried; Sonja J Prohaska; Wendy J Bailey; Bernhard Y Misof; Frank H Ruddle; Günter P Wagner
Journal:  Mol Phylogenet Evol       Date:  2004-09       Impact factor: 4.286

10.  Hox gene clusters in the Indonesian coelacanth, Latimeria menadoensis.

Authors:  Esther G L Koh; Kevin Lam; Alan Christoffels; Mark V Erdmann; Sydney Brenner; Byrappa Venkatesh
Journal:  Proc Natl Acad Sci U S A       Date:  2003-01-23       Impact factor: 11.205

View more
  14 in total

1.  The coelacanth: Can a "living fossil" have active transposable elements in its genome?

Authors:  Magali Naville; Domitille Chalopin; Didier Casane; Patrick Laurenti; Jean-Nicolas Volff
Journal:  Mob Genet Elements       Date:  2015-05-27

2.  Large-scale sequencing of flatfish genomes provides insights into the polyphyletic origin of their specialized body plan.

Authors:  Zhenming Lü; Li Gong; Yandong Ren; Yongjiu Chen; Zhongkai Wang; Liqin Liu; Haorong Li; Xianqing Chen; Zhenzhu Li; Hairong Luo; Hui Jiang; Yan Zeng; Yifan Wang; Kun Wang; Chen Zhang; Haifeng Jiang; Wenting Wan; Yanli Qin; Jianshe Zhang; Liang Zhu; Wei Shi; Shunping He; Bingyu Mao; Wen Wang; Xiaoyu Kong; Yongxin Li
Journal:  Nat Genet       Date:  2021-04-19       Impact factor: 38.330

3.  Hox cluster characterization of Banna caecilian (Ichthyophis bannanicus) provides hints for slow evolution of its genome.

Authors:  Riga Wu; Qingfeng Liu; Shaoquan Meng; Peng Zhang; Dan Liang
Journal:  BMC Genomics       Date:  2015-06-18       Impact factor: 3.969

4.  'Monster… -omics': on segmentation, re-segmentation, and vertebrae formation in amphibians and other vertebrates.

Authors:  David Buckley; Viktor Molnár; Gábor Németh; Ors Petneházy; Judit Vörös
Journal:  Front Zool       Date:  2013-04-11       Impact factor: 3.172

5.  An independent genome duplication inferred from Hox paralogs in the American paddlefish--a representative basal ray-finned fish and important comparative reference.

Authors:  Karen D Crow; Christopher D Smith; Jan-Fang Cheng; Günter P Wagner; Chris T Amemiya
Journal:  Genome Biol Evol       Date:  2012-07-31       Impact factor: 3.416

6.  Salamander Hox clusters contain repetitive DNA and expanded non-coding regions: a typical Hox structure for non-mammalian tetrapod vertebrates?

Authors:  Stephen Randal Voss; Srikrishna Putta; John A Walker; Jeramiah J Smith; Nobuyasu Maki; Panagiotis A Tsonis
Journal:  Hum Genomics       Date:  2013-04-05       Impact factor: 4.639

7.  Building a robust a-p axis.

Authors:  Alysha Heimberg; Edwina McGlinn
Journal:  Curr Genomics       Date:  2012-06       Impact factor: 2.236

Review 8.  Evolution of Hox gene clusters in deuterostomes.

Authors:  Juan Pascual-Anaya; Salvatore D'Aniello; Shigeru Kuratani; Jordi Garcia-Fernàndez
Journal:  BMC Dev Biol       Date:  2013-07-02       Impact factor: 1.978

9.  Enigmatic orthology relationships between Hox clusters of the African butterfly fish and other teleosts following ancient whole-genome duplication.

Authors:  Kyle J Martin; Peter W H Holland
Journal:  Mol Biol Evol       Date:  2014-06-27       Impact factor: 16.240

10.  Selection on different genes with equivalent functions: the convergence story told by Hox genes along the evolution of aquatic mammalian lineages.

Authors:  Mariana F Nery; Brunno Borges; Aline C Dragalzew; Tiana Kohlsdorf
Journal:  BMC Evol Biol       Date:  2016-05-21       Impact factor: 3.260

View more

北京卡尤迪生物科技股份有限公司 © 2022-2023.