BACKGROUND: While protease-activated-receptor 1 (PAR(1)) plays a central role in tumor progression, little is known about the cell signaling involved. METHODOLOGY/PRINCIPAL FINDINGS: We show here the impact of PAR(1) cellular activities using both an orthotopic mouse mammary xenograft and a colorectal-liver metastasis model in vivo, with biochemical analyses in vitro. Large and highly vascularized tumors were generated by cells over-expressing wt hPar1, Y397Z hPar1, with persistent signaling, or Y381A hPar1 mutant constructs. In contrast, cells over-expressing the truncated form of hPar1, which lacks the cytoplasmic tail, developed small or no tumors, similar to cells expressing empty vector or control untreated cells. Antibody array membranes revealed essential hPar1 partners including Etk/Bmx and Shc. PAR(1) activation induces Etk/Bmx and Shc binding to the receptor C-tail to form a complex. Y/A mutations in the PAR(1) C-tail did not prevent Shc-PAR(1) association, but enhanced the number of liver metastases compared with the already increased metastases obtained with wt hPar1. We found that Etk/Bmx first binds via the PH domain to a region of seven residues, located between C378-S384 in PAR(1) C-tail, enabling subsequent Shc association. Importantly, expression of the hPar1-7A mutant form (substituted A, residues 378-384), which is incapable of binding Etk/Bmx, resulted in inhibition of invasion through Matrigel-coated membranes. Similarly, knocking down Etk/Bmx inhibited PAR(1)-induced MDA-MB-435 cell migration. In addition, intact spheroid morphogenesis of MCF10A cells is markedly disrupted by the ectopic expression of wt hPar1. In contrast, the forced expression of the hPar1-7A mutant results in normal ball-shaped spheroids. Thus, by preventing binding of Etk/Bmx to PAR(1) -C-tail, hPar1 oncogenic properties are abrogated. CONCLUSIONS/SIGNIFICANCE: This is the first demonstration that a cytoplasmic portion of the PAR(1) C-tail functions as a scaffold site. We identify here essential signaling partners, determine the hierarchy of binding and provide a platform for therapeutic vehicles via definition of the critical PAR(1)-associating region in the breast cancer signaling niche.
BACKGROUND: While protease-activated-receptor 1 (PAR(1)) plays a central role in tumor progression, little is known about the cell signaling involved. METHODOLOGY/PRINCIPAL FINDINGS: We show here the impact of PAR(1) cellular activities using both an orthotopic mouse mammary xenograft and a colorectal-liver metastasis model in vivo, with biochemical analyses in vitro. Large and highly vascularized tumors were generated by cells over-expressing wt hPar1, Y397Z hPar1, with persistent signaling, or Y381AhPar1 mutant constructs. In contrast, cells over-expressing the truncated form of hPar1, which lacks the cytoplasmic tail, developed small or no tumors, similar to cells expressing empty vector or control untreated cells. Antibody array membranes revealed essential hPar1 partners including Etk/Bmx and Shc. PAR(1) activation induces Etk/Bmx and Shc binding to the receptor C-tail to form a complex. Y/A mutations in the PAR(1) C-tail did not prevent Shc-PAR(1) association, but enhanced the number of liver metastases compared with the already increased metastases obtained with wt hPar1. We found that Etk/Bmx first binds via the PH domain to a region of seven residues, located between C378-S384 in PAR(1) C-tail, enabling subsequent Shc association. Importantly, expression of the hPar1-7A mutant form (substituted A, residues 378-384), which is incapable of binding Etk/Bmx, resulted in inhibition of invasion through Matrigel-coated membranes. Similarly, knocking down Etk/Bmx inhibited PAR(1)-induced MDA-MB-435 cell migration. In addition, intact spheroid morphogenesis of MCF10A cells is markedly disrupted by the ectopic expression of wt hPar1. In contrast, the forced expression of the hPar1-7A mutant results in normal ball-shaped spheroids. Thus, by preventing binding of Etk/Bmx to PAR(1) -C-tail, hPar1 oncogenic properties are abrogated. CONCLUSIONS/SIGNIFICANCE: This is the first demonstration that a cytoplasmic portion of the PAR(1) C-tail functions as a scaffold site. We identify here essential signaling partners, determine the hierarchy of binding and provide a platform for therapeutic vehicles via definition of the critical PAR(1)-associating region in the breast cancer signaling niche.
Protease-activated receptor-1 (PAR1), a G protein-coupled receptor (GPCR), is the first and prototype member of the mammalian PAR family, which comprises four genes. The activation of PAR1 involves the release of an N-terminal peptide and the exposure of an otherwise hindered ligand, resulting in an exclusive mode of activation and a general paradigm for the entire PAR family (1–3). While a well-known classical observation points to a tight link between hyper-activation of the coagulation system and cancer malignancies, the molecular mechanism that governs pro-coagulant tumor progression remains poorly defined [, [2], [3. Surprisingly, the zinc-dependent matrix-metalloprotease 1 (MMP-1), a collagenase that efficiently cleaves extracellular matrix (ECM) and basement membrane components, has been shown to specifically activate PAR1
[4]. The PAR1 -MMP1 axis may thus provide a direct mechanistic link between PAR1 and tumor metastasis.Levels of hPar1 expression and epithelial tumor progression are correlated in both clinically obtained biopsy specimens and a wide spectrum of differentially metastatic cell lines [5], [6]. PAR1 also plays a role in the physiological invasion process of placental cytotrophoblasts during implantation into the uterus decidua [7]. Trophoblast invasion shares many features with the tumor cell invasion process; it differs, however, by the time-limited hPar1 expression, which is confined to the trophoblast-invasive period, and is shut off immediately thereafter, when the need to invade disappears [7]. This provides strong support for the idea that the hPar1 gene is part of an invasive gene program.Importantly, PAR1 cellular trafficking and signal termination appear to occur in a different mode than other GPCRs. Instead of recycling back to the cell surface after ligand stimulation, activated PAR1 is sorted to the lysosomes and degraded [8], [9]. Aberrant PAR1 trafficking, resulting in receptor-populated cell surfaces and causing prolonged and persistent signals, has been found in breast cancer [10]. While cellular trafficking of PAR1 impinges on the extent and mode of signaling, identification of individual PAR1 signaling partners and their contribution to breast cancer progression remain to be elucidated.In the present study, we have identified PAR1 C-tail as a scaffold site for the immobilization of signaling partners. In addition to identifying key partners, we have determined the hierarchy of binding and established a region in PAR1 C-tail critical for breast cancer signaling. The association of Etk/Bmx and Shc to form a physical complex with PAR1 C-tail is demonstrated. The prime link of Etk/Bmx to PAR1 is mediated via its PH domain, enabling the subsequent immobilization of Shc. The physiological significance of PAR1-Etk/Bmx binding is emphasized by the inhibition of Matrigel invasion and appearance of nearly intact acini morphogenesis of polarized cell architecture when this site is mutated. The use of consecutive A residues inserted into the proposed Etk/Bmx binding region of PAR1 C-tail (e.g., hPar1-7A) abolished PAR1 -induced pro-oncogenic properties. Thus, by preventing the binding of a key signaling partner to PAR1 C-tail, efficient inhibition of PAR1 -induced tumor-associated functions, including loss of epithelial cell polarity, migration and invasion through basement membranes, is obtained. Elucidation of the PAR1 C-tail binding domain may provide a platform for new therapeutic vehicles in treating breast cancer.
Results
PAR1-enhanced tumor growth and angiogenesis in vivo is abrogated in the presence of a truncated PAR1 form
To investigate the role of PAR1 signaling in breast tumor growth and vascularization in vivo, we over-expressed wt hPar1 and deletion constructs [e.g., L369Z, which lacks the entire cytoplasmic tail, and Y397Z, which exhibits persistent signaling due to impaired internalization [11], [12]] in MCF7 cells. The functional outcome of MCF7 cells over-expressing various hPar1 constructs in vivo was assessed by orthotopic mammary fat pad tumor development (proper expression and characterization of the plasmids are shown in Figure S1). MCF7 cells over-expressing either Y397Z or wt hPar1 constructs (e.g., MCF7/Y397Z hPar1; MCF7/wt hPar1) markedly enhanced tumor growth in vivo following implantation into the mammary glands (Fig. 1C and D), whereas MCF7 cells over-expressing truncated hPar1 behaved similar to control MCF7 cells in vector-injected mice, which developed only very small tumors (Fig. 1C). The tumors obtained with MCF7/wt hPar1 and MCF7/Y397Z hPar1 were 5 and 5.8 times larger, respectively, than tumors produced by the MCF7/empty vector-transfected cells. Histological examination (H&E staining) showed that while both MCF7/wt hPar1 and MCF7/Y397Z hPar1tumors infiltrated into the fat pad tissues of the breast, the MCF7/Y397Z hPar1tumors further infiltrated the abdominal muscle (Fig. 1D). In contrast, tumors produced by empty vector or truncated hPar1-transfected cells were capsulated, with no obvious cell invasion. Proliferation levels were evaluated by immunostaining with Ki-67 and were 3 times higher in Y397Z hPar1 or wt hPar1tumors (Fig. 2) than in the small tumors produced by either empty vector or truncated hPar1-transfected cells (p<0.0001, Fig. 2B). Tumor growth can also be attributed to blood vessel formation [13], [14]. The hPar1-induced breast tumor vascularization was assessed by immunostaining with anti-lectin- and anti-CD31 antibodies. Both MCF7/Y397Z and MCF7/wt hPar1tumors were intensely stained (Fig. 2A; Bii and iii). In contrast, only a few blood vessels were found in the small tumors of empty vector or truncated hPar1 (Fig. 2A; Bii and iii). Thus, both MCF7/wt hPar1 and MCF7/Y397Z hPar1 cells were shown to effectively induce breast tumor growth, proliferation and angiogenesis, while the MCF7/truncated hPar1 and MCF7/empty vector-expressing cells had no significant effect.
Figure 1
PAR1 enhances tumor growth and angiogenesis in a xenograft mouse model.
A
i. Schematic representation of the hPar1 constructs. wt hPar1, truncated hPar1 (devoid of the cytoplasmic tail), Y397Z hPar1 (shorter C-tail of persistent signaling). A
ii. Semi-quantitative RT-PCR analysis of various hPar1 constructs. RT-PCR analysis of cells transfected with wt hPar1, Y397Z hPar1, truncated hPar1 or empty vector using primers to PAR1 N-terminus (upper panel), C-terminus (middle panel), or GAPDH (lower panel). PAR1 N-terminus primers were as follows: hPar1-sense: 5′- CTCGTCCTCAAGGAGCAAAC-3′, antisense orientation: 5′-TGGGATCGGAACTTTCTTTG-3' (564-bp PCR product). PAR1 C-tail primers – sense: 5′-TAC TAT TAC GCT GGA TCC TCT GAG-3′ and antisense: 5′-CTT GAA TTC CTA AGT TAA CAGCTT-3′. These primers give rise to a 181-bp product corresponding to the entire PAR1 C-tail site, as follows: YY – YASSECQRYVYSILCCKESSDPSYNSSGQLMASKMDTCSSNLNNSIYKKLLT. B. Western blot analyses of MCF7 cells expressing various hPar1 constructs. a. Mock-transfected MCF7; b. Y397Z hPar1; c. Truncated hPar1; d. wt hPar1. C.
Mouse mammary tumor growth in animals implanted with cells expressing wt hPar1 and variants. MCF7 cells expressing various hPar1 were inoculated into the mammary pads of mice. Tumor volumes (mean ± SD) are shown for wt hPar1 (▪), Y397Z hPar1 (□), truncated hPar1 (Δ), and empty vector (▴; tumor volume 30±3 mm3)(* P<0.005). D. Morphological appearance. The Y397Z hPar1 and wt hPar1 constructs exhibited intense vascularization and appeared reddish as opposed to the pale appearance of tumors generated by either empty vector or truncated hPar1. Tissue sections of tumors were stained with H&E (right panels). Magnification is ×100.
Figure 2
Proliferation and blood vessel formation in tumors produced by hPar1 constructs.
A. Sections of tumors generated by various hPar1 constructs were subjected to immunohistochemical staining with Ki-67 for proliferation (upper panel), and with either an endothelial cell-specific lectin or anti-CD31 to visualize blood vessels (lower panel). B
i. Ki-67-positive cells were counted in five microscope fields per tumor section, and the mean (± SD) number of cells per high power field (HPF) was determined. Significantly, fewer Ki-67-positive cells were observed in tumors produced by the empty vector or truncated hPar1 constructs than with wt hPar1 or Y397Z hPar1. B
ii and iii. Anti-lectin- or anti-CD31-stained cells, respectively, were counted as described in (Bi). The morphometric analysis used to evaluate proliferation and blood vessels was performed as explained in Materials& Methods under the section of histological evaluation and scoring. Briefly, the microscope was calibrated with a micrometer slide before each measurement. Five microscopic fields were screened, 10 cells/field were selected and no less than 50 cells/tumor case were assessed. Error bars show +/− SD of mean and the P value was determined (** P<0.005 * P<0.001; Chi- square test). The data are representative of four independent experiments performed in triplicates.
PAR1 enhances tumor growth and angiogenesis in a xenograft mouse model.
A
i. Schematic representation of the hPar1 constructs. wt hPar1, truncated hPar1 (devoid of the cytoplasmic tail), Y397Z hPar1 (shorter C-tail of persistent signaling). A
ii. Semi-quantitative RT-PCR analysis of various hPar1 constructs. RT-PCR analysis of cells transfected with wt hPar1, Y397Z hPar1, truncated hPar1 or empty vector using primers to PAR1 N-terminus (upper panel), C-terminus (middle panel), or GAPDH (lower panel). PAR1 N-terminus primers were as follows: hPar1-sense: 5′- CTCGTCCTCAAGGAGCAAAC-3′, antisense orientation: 5′-TGGGATCGGAACTTTCTTTG-3' (564-bp PCR product). PAR1 C-tail primers – sense: 5′-TAC TAT TAC GCT GGA TCC TCT GAG-3′ and antisense: 5′-CTT GAA TTC CTA AGT TAA CAGCTT-3′. These primers give rise to a 181-bp product corresponding to the entire PAR1 C-tail site, as follows: YY – YASSECQRYVYSILCCKESSDPSYNSSGQLMASKMDTCSSNLNNSIYKKLLT. B. Western blot analyses of MCF7 cells expressing various hPar1 constructs. a. Mock-transfected MCF7; b. Y397Z hPar1; c. Truncated hPar1; d. wt hPar1. C.
Mouse mammary tumor growth in animals implanted with cells expressing wt hPar1 and variants. MCF7 cells expressing various hPar1 were inoculated into the mammary pads of mice. Tumor volumes (mean ± SD) are shown for wt hPar1 (▪), Y397Z hPar1 (□), truncated hPar1 (Δ), and empty vector (▴; tumor volume 30±3 mm3)(* P<0.005). D. Morphological appearance. The Y397Z hPar1 and wt hPar1 constructs exhibited intense vascularization and appeared reddish as opposed to the pale appearance of tumors generated by either empty vector or truncated hPar1. Tissue sections of tumors were stained with H&E (right panels). Magnification is ×100.
Proliferation and blood vessel formation in tumors produced by hPar1 constructs.
A. Sections of tumors generated by various hPar1 constructs were subjected to immunohistochemical staining with Ki-67 for proliferation (upper panel), and with either an endothelial cell-specific lectin or anti-CD31 to visualize blood vessels (lower panel). B
i. Ki-67-positive cells were counted in five microscope fields per tumor section, and the mean (± SD) number of cells per high power field (HPF) was determined. Significantly, fewer Ki-67-positive cells were observed in tumors produced by the empty vector or truncated hPar1 constructs than with wt hPar1 or Y397Z hPar1. B
ii and iii. Anti-lectin- or anti-CD31-stained cells, respectively, were counted as described in (Bi). The morphometric analysis used to evaluate proliferation and blood vessels was performed as explained in Materials& Methods under the section of histological evaluation and scoring. Briefly, the microscope was calibrated with a micrometer slide before each measurement. Five microscopic fields were screened, 10 cells/field were selected and no less than 50 cells/tumor case were assessed. Error bars show +/− SD of mean and the P value was determined (** P<0.005 * P<0.001; Chi- square test). The data are representative of four independent experiments performed in triplicates.
PAR1 C-tail binds the Shc adaptor protein
To identify proteins that associate with the PAR1 C-terminus and participate in the tumor signaling pathway, we fused the cytoplasmic tail of hPar1 to a GST protein and used the construct as “bait” to specifically detect associated proteins. Lysates obtained from a highly metastatic breast carcinoma line (e.g., MDA-MB-435 cells) were assessed for binding to the GST- PAR1 C-tail column. Amino acid sequence analysis of proteins bound to the column repeatedly indicated the presence of the Shc adapter protein. Indeed, application of MDA-MB-435 cell lysates onto a GST- PAR1 C-tail column or a GST control column showed the three Shc isoforms specifically bound to the GST- PAR1 -C-tail column, but not to the GST control column (Fig. 3A). Shc isoforms refer to a series of proteins (e.g., 66, 52 and 46 kDa) termed Shc (Src homology 2/α-collagen–related) [15], [16]. cDNA analyses of the family proteins has demonstrated that the 46- and 52-kDa species arise from alternative translation initiation sites within the same transcript, giving rise to a 59-amino acid terminal truncation of the 46-kDa isoform compared to the 52-kDa isoform. In contrast, the 66-kDa species most likely arises from an alternatively spliced message since there is only one Shc gene and the carboxy terminal antibodies cross react with all three molecular weight species. Co-immunoprecipitation studies using either PAR1 (Fig. 3B) or Shc antibodies (Fig. 3C) confirmed the PAR1 -Shc association 5 min after TFLLRNPNDK activation; this association remained high during the 30 min of analysis (Fig. 3B and C). The Shc protein comprises multiple protein docking sites, including SH2, phospho-tyrosine binding site (PTB) and collagen homology domains 1 and 2 (CH1, CH2). When a GST-Shc-SH2 domain pull-down assay was used following loading with PAR1 activated MDA-MB-435 cell lysates, we obtained PAR1 -specific binding to the Shc-SH2 domain. In contrast, when the tandem SH2 domain from an irrelevant protein was used as a control, no binding of PAR1 was observed (Fig. 3D).
Figure 3
PAR1 C-tail recruits Shc adaptor protein.
A.
PAR MDA-MB-435 cell lysates were applied to a GST- PAR1 C-tail or GST control column. After an adequate binding period of the designated cell lysates to the columns, a washing step was performed. This step was performed in order to wash out all non-specific proteins, leaving the GST- PAR1 -C-tail column firmly bound to targeted cell lysate proteins. Next, specifically-bound proteins were eluted via the addition of gel “sample buffer” and detected by western blot analysis using anti-Shc antibodies. B and C. Co-immunoprecipitation analyses of PAR Lysates of non-activated or TFLLRNPNDK-activated MDA-MB-435 cells were co-immunoprecipitated with either anti- PAR1 (B) or anti-Shc (C) antibodies. D. PAR MDA-MB-435 cell lysates were loaded onto columns of GST-Shc-SH2, GST linked to a tandem SH2 from a non-relevant protein, or GST alone. Specifically-bound proteins were eluted and detected with anti- PAR1 antibodies. E
. Schematic representation of PAR. The scheme illustrates PAR1 structure. IL - internal ligand, TM - transmembrane. Important tyrosine (Y) residues are indicated and the conserved sequence is gray. Serine residues in the C-tail region that may be involved in PAR1 -Shc association are indicated in red. E
. Analysis of PAR. Y381, Y397 and Y420 were scored highly likely to undergo phosphorylation, as shown in the table. “Pred” means “prediction” for the predicted score of each of the Y tyrosine residues that is relevant to phosphorylation.
PAR1 C-tail recruits Shc adaptor protein.
A.
PAR MDA-MB-435 cell lysates were applied to a GST- PAR1 C-tail or GST control column. After an adequate binding period of the designated cell lysates to the columns, a washing step was performed. This step was performed in order to wash out all non-specific proteins, leaving the GST- PAR1 -C-tail column firmly bound to targeted cell lysate proteins. Next, specifically-bound proteins were eluted via the addition of gel “sample buffer” and detected by western blot analysis using anti-Shc antibodies. B and C. Co-immunoprecipitation analyses of PAR Lysates of non-activated or TFLLRNPNDK-activated MDA-MB-435 cells were co-immunoprecipitated with either anti- PAR1 (B) or anti-Shc (C) antibodies. D. PAR MDA-MB-435 cell lysates were loaded onto columns of GST-Shc-SH2, GST linked to a tandem SH2 from a non-relevant protein, or GST alone. Specifically-bound proteins were eluted and detected with anti- PAR1 antibodies. E
. Schematic representation of PAR. The scheme illustrates PAR1 structure. IL - internal ligand, TM - transmembrane. Important tyrosine (Y) residues are indicated and the conserved sequence is gray. Serine residues in the C-tail region that may be involved in PAR1 -Shc association are indicated in red. E
. Analysis of PAR. Y381, Y397 and Y420 were scored highly likely to undergo phosphorylation, as shown in the table. “Pred” means “prediction” for the predicted score of each of the Y tyrosine residues that is relevant to phosphorylation.While searching for the PAR1 C-tail putative tyrosine residues capable of undergoing phosphorylation and serving as possible binding sites for the Shc protein (NetPhos 2.0 server), we found four candidates: Y381, Y383, Y397, Y420 (Fig. 3E
i and ii). Of these, only three were predicted to undergo phosphorylation: Y381, Y397 and Y420 (Fig. 3E
ii). Since our preliminary data showed that Y397Z hPar1 was potent in signaling (Figs 1 and 2) and able to associate with Shc when transiently expressed in COS-1 cells (data not shown), we postulated that the Shc binding site(s) in the PAR1 C-tail is/are located upstream of tyrosine 397. Indeed, sequence alignment of PAR1 C-tail in nine different species demonstrates several highly conserved regions (data not shown), among which are the Y381VY383 residues. Replacement of the relevant tyrosine (Y) residues upstream to Y397Z hPar1 with alanine (Ala, A) (e.g., Y381A or Y383A and the double mutant Y381A & Y383A) did not prevent the recruitment and physical association between Shc and PAR1 (for more details see section of “Hierarchy of binding”, bellow).
Y exhibits high metastatic potential
We further demonstrated the functionality of the Y mutant in vivo using a colorectal-liver metastasis model (18), which provides a rapid metastatic model of liver foci formation. MouseCT-26colon carcinoma cells were genetically engineered to over-express wt hPar1, Y or empty vector constructs. These over-expressing cells were injected intra-splenically into CB6F1 mice (either PAR1 -activated or not) to generate liver metastases. Tumor growth kinetics and liver metastatic foci appearance were monitored twice a week by MRI. Both wt hPar1 and Y enhanced liver metastatic foci formation, compared to control CT-26 cells. Furthermore, mice inoculated with cells expressing Y showed especially extensive and rapid appearance of liver metastasis as compared to mice inoculated with cells over-expressing wt hPar1 (Fig. 4). Representative MRI images (Fig. 4A) of excised livers and histological sections (Fig. 4B), obtained on day 16, demonstrated high metastatic potential of both activated Y and wt hPar1. An elevated number of metastatic foci were observed with the wt hPar1 after PAR1 activation (Fig. 4A), and an even more dramatic increase was obtained with the activated Y construct (Fig. 4A, C). Quantification of liver metastasis as a function of time is shown in Figure 4C. These results emphasized that the Y mutated construct is at least as functional as the wt hPar1, and the substitution of Y to A did not impair the ability of hPar1 to initiate signaling and therefore result in metastasis. The results may further suggest that Shc does not bind directly to PAR1 C-tail, since replacement of a key tyrosine residue by alanine (Y381A) does not impair PAR1 function as manifested by metastatic foci formation. It is thus postulated that whereas Shc is not associated with PAR1 via the traditional tyrosine-phosphorylated-SH2 complex formation, it probably involves a third mediator connecting with PAR1. The molecular mechanism of Y-enhanced liver metastasis remains to be fully elucidated.
Figure 4
Y construct enhances liver metastasis formation.
A. MRI analysis. CT-26 mouse carcinoma cells (that do not express endogenous hPar1), ectopically forced to express either wt hPar1 or Y constructs, were injected intra-splenically into CB6F1 mice to generate liver metastases. Tumor assessment was performed using T2W fast SE images (TR/TE = 2000/40 ms). Representative axial liver sections of wt hPar1 or Y CT-26-transfected cells, obtained at day 16, in the absence (left panel) or presence (right panel) of SFLLRN, are seen. Liver margins are marked with a dashed green line; yellow lines mark tumor foci; scale bar represents a size of 1 cm and applies to all the images in A. B. Anatomical and histological examination. Gross anatomical photos (Top) and H&E staining of liver sections (harvested on day 16) of activated wt hPar1or Y CT-26 cells. T = tumor and N = normal; yellow lines mark tumor foci; original magnification ×100. C.
Histogram of the number of liver metastases per mouse as measured by MRI. The experiments were performed in the presence or absence of the PAR1 agonist peptide (n = 3–5 mice/group). Activation of PAR1 accelerated both tumor size and the number of detectable foci as well as their time of appearance. X stands for sacrificed mice with overloaded liver tumors.
Y construct enhances liver metastasis formation.
A. MRI analysis. CT-26mousecarcinoma cells (that do not express endogenous hPar1), ectopically forced to express either wt hPar1 or Y constructs, were injected intra-splenically into CB6F1 mice to generate liver metastases. Tumor assessment was performed using T2W fast SE images (TR/TE = 2000/40 ms). Representative axial liver sections of wt hPar1 or Y CT-26-transfected cells, obtained at day 16, in the absence (left panel) or presence (right panel) of SFLLRN, are seen. Liver margins are marked with a dashed green line; yellow lines mark tumor foci; scale bar represents a size of 1 cm and applies to all the images in A. B. Anatomical and histological examination. Gross anatomical photos (Top) and H&E staining of liver sections (harvested on day 16) of activated wt hPar1or Y CT-26 cells. T = tumor and N = normal; yellow lines mark tumor foci; original magnification ×100. C.
Histogram of the number of liver metastases per mouse as measured by MRI. The experiments were performed in the presence or absence of the PAR1 agonist peptide (n = 3–5 mice/group). Activation of PAR1 accelerated both tumor size and the number of detectable foci as well as their time of appearance. X stands for sacrificed mice with overloaded liver tumors.
Antibody-array for protein-protein interactions reveals signaling candidates
To detect the putative mediator(s) linking PAR1 to potential signaling proteins, we examined custom-made antibody-array membranes. For this purpose, aggressive breast carcinomaMDA-MB-435 cells (with high hPar1 levels) were incubated with the antibody-array membranes before and after PAR1 activation (15 minutes). This identified several activation-dependent proteins which interact with PAR1, including ICAM, c-Yes, Shc and Etk/Bmx (see Figure S2). Of these proteins, we chose to focus here on Etk/Bmx and Shc.The epithelial tyrosine kinase (Etk), also known as Bmx, is a non-receptor tyrosine kinase that is unique by virtue of being able to interact with both tyrosine kinase receptors and GPCRs [17]. This type of interaction is mainly attributed to the pleckstrin homology (PH) which is followed by the Src homology SH3 and SH2 domains and a tyrosine kinase site [18]. Etk/Bmx- PAR1 interactions were characterized by binding lysates exhibiting various hPar1 forms to GST-Etk/Bmx. While Y397Z hPar1 and wt hPar1 showed specific association with Etk/Bmx, lysates of truncated hPar1 or JAR cells (lacking PAR1) exhibited no binding (Fig. 5A). In order to substantiate the physical association between PAR1 C-tail and Etk/Bmx-PH domain we proteolytically cleaved the C-tail portion of both wt- and Y381AhPar1-modified tail and applied the purified fragments onto a GST-PH Etk/Bmx column. Specific binding was observed with both the wt hPar1 and Y purified C-tails (Fig. 5B). Next, we analyzed various modified PAR1-GST-C tail constructs (e.g., wt hPar1, Y and Y) for binding to either wt- or kinase-inactive Etk/Bmx (KQ) cell lysates [18], [19]. A tight association between the PAR1 C-tail and Etk/Bmx was obtained, independent of whether wt hPar1 or the Y/A mutant forms of PAR1 C-tail were examined. This was true for both wt- and KQ-Etk mutant (Fig. 5C).
Figure 5
Physical association between PAR1 and Etk/Bmx.
A. PAR Lysates of cells over-expressing Y397Z, wt or truncated hPar1, and lysates of cells that do not express PAR1 (e.g., JAR) were applied to a GST-Etk-PH column. Noticeably, highly metastatic MDA-435 cells express high levels of PAR1 Specifically-bound proteins were detected using anti- PAR1 antibodies. While Y397Z and wt hPar1 showed specific PAR1 association, lysates of the truncated hPar1 or JAR cells showed no binding. B. Purified PAR PAR1 C-tail was cleaved from the immobilized GST-C-tail, purified and re-applied onto a GST-Etk-PH domain column. Specific binding is observed regardless of whether purified wt or mutant cleaved C-tail is analyzed. No binding was observed when only GST beads were used. C. GST- PAR Lysates of HEK293 cells transfected with either Etk/Bmx (A–D) or kinase-inactive Etk/Bmx (KQ; E–G), applied on various GST-PAR1-C-tail columns (PAR1-C-tail of wt, Y, Y) or GST-control column. The GST-C-tails from either wt hPar1 or mutants Y are strongly associated with both wt (A–D) and kinase-inactive (KQ; E–G) Etk/Bmx. Control-free GST did not show any binding of KQ Etk/Bmx (data not shown). Specifically-bound proteins were identified using anti-Etk/Bmx antibodies. Levels of GST were used as a control for protein loading. D. Immunohistological staining of PAR Antibodies directed against PAR1 (upper panel) or Etk/Bmx (lower panel) were applied to normal and cancerous breast tissue specimens. The cancerous tissues include DCIS (ductal carcinoma in situ), IDC (invasive ductal carcinoma) and lobular invasive carcinoma (lobular carcinoma). The combined histological results were assessed and scored as outlined in the Materials and Methods section. The measurements per slide section was carried out using anatomical compartments, using an ocular micrometer (WHIOX2, Olympus, New Jersey, USA). The microscope was calibrated with a micrometer slide before each measurement. All measurements were performed on the monitor screen using a ×40 objective. On examining the sections for selection of fields tumor cells from the most cellular area at the center of the tumor were selected. Necrotic and inflammatory area were avoided. Eight microscopic fields were screened, 10 cells/field were selected and no less than 50 cells/tumor case were assessed. The positive rate of staining is expressed as a mean ± SD per tumor histological subtype from selected cases. Specific staining is observed in both PAR1 and Etk/Bmx, with particularly strong staining seen in IDC and lobular carcinoma. No staining is seen in the normal breast tissue. This staining represents total of 36 cases as outlined for each histological subtype in the table below, performed three times per category.
Physical association between PAR1 and Etk/Bmx.
A. PAR Lysates of cells over-expressing Y397Z, wt or truncated hPar1, and lysates of cells that do not express PAR1 (e.g., JAR) were applied to a GST-Etk-PH column. Noticeably, highly metastatic MDA-435 cells express high levels of PAR1 Specifically-bound proteins were detected using anti- PAR1 antibodies. While Y397Z and wt hPar1 showed specific PAR1 association, lysates of the truncated hPar1 or JAR cells showed no binding. B. Purified PAR PAR1 C-tail was cleaved from the immobilized GST-C-tail, purified and re-applied onto a GST-Etk-PH domain column. Specific binding is observed regardless of whether purified wt or mutant cleaved C-tail is analyzed. No binding was observed when only GST beads were used. C. GST- PAR Lysates of HEK293 cells transfected with either Etk/Bmx (A–D) or kinase-inactive Etk/Bmx (KQ; E–G), applied on various GST-PAR1-C-tail columns (PAR1-C-tail of wt, Y, Y) or GST-control column. The GST-C-tails from either wt hPar1 or mutants Y are strongly associated with both wt (A–D) and kinase-inactive (KQ; E–G) Etk/Bmx. Control-free GST did not show any binding of KQ Etk/Bmx (data not shown). Specifically-bound proteins were identified using anti-Etk/Bmx antibodies. Levels of GST were used as a control for protein loading. D. Immunohistological staining of PAR Antibodies directed against PAR1 (upper panel) or Etk/Bmx (lower panel) were applied to normal and cancerous breast tissue specimens. The cancerous tissues include DCIS (ductal carcinoma in situ), IDC (invasive ductal carcinoma) and lobular invasive carcinoma (lobular carcinoma). The combined histological results were assessed and scored as outlined in the Materials and Methods section. The measurements per slide section was carried out using anatomical compartments, using an ocular micrometer (WHIOX2, Olympus, New Jersey, USA). The microscope was calibrated with a micrometer slide before each measurement. All measurements were performed on the monitor screen using a ×40 objective. On examining the sections for selection of fields tumor cells from the most cellular area at the center of the tumor were selected. Necrotic and inflammatory area were avoided. Eight microscopic fields were screened, 10 cells/field were selected and no less than 50 cells/tumor case were assessed. The positive rate of staining is expressed as a mean ± SD per tumor histological subtype from selected cases. Specific staining is observed in both PAR1 and Etk/Bmx, with particularly strong staining seen in IDC and lobular carcinoma. No staining is seen in the normal breast tissue. This staining represents total of 36 cases as outlined for each histological subtype in the table below, performed three times per category.
Differential expression of Etk/Bmx in breast biopsies
PAR1 is highly expressed in breast carcinoma specimens, but not in normal breast tissue, as evidenced by in situ hybridization analyses [5], [20]. Immunohistochemical staining of PAR1 tissue sections confirms the earlier described RNA riboprobe analysis for hPar1. Invasive carcinoma specimens were selected from infiltrating ductal carcinoma (IDC) of high nuclear grade and with evidence of vascular invasion and lymph node metastases. Immunohistological analyses of both PAR1 and Etk/Bmx showed little staining in comedo DCIS and ductal carcinoma in situ, but high levels of staining in IDC and lobular carcinoma (Fig. 5D; Table 1). These results further suggest a direct correlation between PAR1 and Etk/Bmx expression in malignant breast cancer progression. PAR1-Etk/Bmx association was also demonstrated by co-immunoprecipitation analysis of MDA-MB-435 cells (expressing both endogenous PAR1 and Etk/Bmx) (Figure S3B).
Table 1
Expression of PAR1 and Etk/Bmx in breast cancer biopsy specimens (representing Fig. 5D).
Histological subtype
Cases(N = 36)
Positive cellsMean ± SD
+1
+2
+3
PAR1
Etk/Bmx
PAR1
Etk/Bmx
PAR1
Etk/Bmx
PAR1
Etk/Bmx
Normal
12
0.8±0.2
1.2±0.2
0
1
0
0
0
0
DCIS
8
12.5±3.7
14±3.0
2 (25%)
1 (12.5%)
6 (75%)
7 (87.5%)
-
-
IDC
9
40±10.5
42±12.3
2 (22%)
1 (11%)
1 (11%)
0
5 (55%)
6 (66%)
Lobular carcinoma
7
45±7.3
43±11.6
1 (14%)
0
1 (14%)
1 (14%)
6 (85%)
5 (71.4%)
Histological scoring of (N) cases: +1 less than 25% positive cells (weak positive); +2 between 25–75% positive cells (moderate); +3 more than 75% of positive cells (strong). All controls were negative (0–5% positive cells). Extent of expression classified by score (1–3), number of positive cells/field (x = 8).
Histological scoring of (N) cases: +1 less than 25% positive cells (weak positive); +2 between 25–75% positive cells (moderate); +3 more than 75% of positive cells (strong). All controls were negative (0–5% positive cells). Extent of expression classified by score (1–3), number of positive cells/field (x = 8).
Hierarchy of binding
Next, we wished to determine the chain of events mediating the signaling of PAR1 C-tail-Shc and Etk/Bmx. To this end, analysis of MCF7 cells that express little to no hPar1 were ectopically forced to over-express hPar1. When co-immunoprecipitation with anti- PAR1 antibodies following PAR1 activation was performed, surprisingly, no Shc was detected in the PAR1 immunocomplex (Fig. 6A; MCF7/hPar1; right panel). Shc association with PAR1 was fully rescued when MCF7 cells were initially co-transfected with Etk/Bmx (Fig. 6A), with abundant assembly of Shc in the immunocomplex. Thus, Etk/Bmx is a critical component that binds to activated PAR1 C-tail and enables subsequent binding of Shc. Shc may bind either to phosphorylated Etk/Bmx, via the SH2 domain, or in an unknown manner to the PAR1 C-tail, provided that Etk/Bmx is present and is PAR1 -bound. One cannot, however, exclude the possibility that Bmx binds first to Shc and only then does the complex of Etk/Bmx-Shc bind to PAR-1.
Figure 6
Hierarchy of Shc and Etk/Bmx binding and identification of binding region on PAR1 C-tail.
A. Etk/Bmx is needed for Shc association with PAR MCF7 cells before (MCF7/hPar1) and after (MCF7/hPar1&Etk/Bmx) forced Etk/Bmx and hPar1 co-immunoprecipitation with Shc. No Shc is immunoprecipitated with activated PAR1 when Etk/Bmx is absent (right panel: MCF7/hPar1; wt hPar1). In contrast, extensive co-immunoprecipitation is seen in the presence of forced Etk/Bmx (MCF7/hPar1&Etk/Bmx). This is true regardless of the various constructs of hPar1 expressed: Y, Y397Z hPar1, Y or wt hPar1. The IP was performed using anti- PAR1 (ATAP, Santa Cruz, CA). B. Peptide competition for PAR Peptide 4, encompassing residues 375–396 of PAR1 C-tail, competes with PAR1 for binding to the GST-PH-Etk/Bmx. Specific binding of PAR1to the GST-PH-Etk/Bmx is inhibited in the presence of increased peptide concentration (200 nM-1 µM). Lower panel: Representative histograms show the relative intensities of the bands expressed as a ratio of PAR1to GST-PH. B
ii. Peptide 5, representing another region (e.g., 379–402), does not compete at a concentration of 1 µM. GST protein serves as a loading control. Lower panel: Representative histograms show the relative intensities of the bands expressed as a ratio of PAR1 to GST.
Hierarchy of Shc and Etk/Bmx binding and identification of binding region on PAR1 C-tail.
A. Etk/Bmx is needed for Shc association with PAR MCF7 cells before (MCF7/hPar1) and after (MCF7/hPar1&Etk/Bmx) forced Etk/Bmx and hPar1 co-immunoprecipitation with Shc. No Shc is immunoprecipitated with activated PAR1 when Etk/Bmx is absent (right panel: MCF7/hPar1; wt hPar1). In contrast, extensive co-immunoprecipitation is seen in the presence of forced Etk/Bmx (MCF7/hPar1&Etk/Bmx). This is true regardless of the various constructs of hPar1 expressed: Y, Y397Z hPar1, Y or wt hPar1. The IP was performed using anti- PAR1 (ATAP, Santa Cruz, CA). B. Peptide competition for PAR Peptide 4, encompassing residues 375–396 of PAR1 C-tail, competes with PAR1 for binding to the GST-PH-Etk/Bmx. Specific binding of PAR1to the GST-PH-Etk/Bmx is inhibited in the presence of increased peptide concentration (200 nM-1 µM). Lower panel: Representative histograms show the relative intensities of the bands expressed as a ratio of PAR1to GST-PH. B
ii. Peptide 5, representing another region (e.g., 379–402), does not compete at a concentration of 1 µM. GST protein serves as a loading control. Lower panel: Representative histograms show the relative intensities of the bands expressed as a ratio of PAR1 to GST.
Identification of PAR1-Etk/Bmx binding region: functional consequences
Peptides (representing various regions in PAR1 C-tail) were used in a competition analysis assay for the binding of PAR1 cell lysates to GST-PH-Etk/Bmx. An 18-amino-acid peptide encompassing residues 375–392 of PAR1 C-tail (e.g., termed peptide 4) yielded a dose-dependent inhibition within the range of 1–1000 nM applied peptide (Fig. 6B). Two other peptides, representing PAR1 C-tail 387–400 (Fig. 6B
ii; termed peptide 5) or residues 393–412 (data not shown), did not compete.Based on the competition assay we prepared mutated hPar1 constructs with successive replacement of seven residues (378–384; CQRYVYS). MCF7 clones expressing either HA-hPar1-7A or HA-wt hPar1 showed the following outcome (characterization and proper expression of the mutant is shown in Figure S4): HA-wt following activation (Fig. 7A). We thus conclude that the critical region for Etk/Bmx binding to PAR1 C-tail resides in the vicinity of CQRYVYS.
Figure 7
Functional consequences of mutant hPar1-7A versus wt hPar1.
A
i. Schematic representation of wt hPar1 and the mutant hPar1-7A. A
ii. The ectopic expression of hPar1-7A mutant construct abrogates binding of Etk/Bmx to PAR Stable clones of either HA-tagged wt hPar1 and/or a mutant construct of HA-hPar1-7A were activated and further analyzed for co-immunoprecipitation of PAR1 with Etk/Bmx. The IP was carried out using anti-HA (sc-7392; Santa Cruz, CA). The blots were detected by anti-Bmx (Transduction Laboratories, BD Biosciences, CA) for the identification of Etk/Bmx-associated PAR1. Levels of the HA-tag (for PAR1) are shown in the middle panel. Similarly, levels of PAR1 are also shown by application of anti- PAR1 (ATAP; Santa Cruz, CA) (lower panel). The right section shows levels of plasmid transfection efficiencies in the cells, as indicated by HA- PAR1 and Etk/Bmx analysis by western blots. As seen, only the wt hPar1 co-immunoprecipitated with Etk/Bmx (wt hPar1), while the mutant HA-hPar1-7A clone (mutant clone hPar1- 7A) failed to co-immunoprecipitate. This takes place under conditions whereby both constructs are well expressed, as evidenced by anti-HA-antibodies (western blot; right panel). B. Matrigel invasion assay of either MCF7 cells stably expressing HA-wt-hPar1and Etk/Bmx, or HA-hPar1-7A mutant and Etk/Bmx. Invading cells were counted and the mean ± SD of ten fields per filter was determined. Stable HA wt hPar1 clone or HA-hPar1-7A mutant clone were co-transfected with Etk/Bmx construct and TFLLRNPNDK-activated. Marked Matrigel invasion is seen in the wt hPar1 and Etk/Bmx clones. Low invasion levels are observed in the presence of hPar1-7A mutant and Etk/Bmx, hPar1 alone, empty vector, vector and Etk/Bmx or PAR1 antagonist. These data are representative of three experiments. C
i. Migration assay for wounding-scratch monolayer cells. MDA-MB-435 cell monolayer (expressing endogenous Etk/Bmx) were scratched to introduce an equal gap-area under the following conditions: control untreated cells, TFLLRNPNDK-activated or SiRNA-Etk/Bmx and TFLLRNPNDK-activated. In this set, rapid closure of the wound was obtained 24 hours under PAR1 activation as compared to control untreated cells. In contrast, no migration and closure of the wound was seen when the Etk/Bmx level of the cells were knocked down and they were TFLLRNPNDK-activated. In another set of wound introduction experiments, attenuated wound closure was seen in the presence of the V antagonist SCH79797 and SFLLR NPNDK PAR1 activation for 24 h, similar to the control untreated cells. These data are representative of four experiments. C
ii. RT-PCR analysis showing the level of Etk/Bmx in MDA-MB-435 cells before and after SiRNA- Etk/Bmx cell infection.
Functional consequences of mutant hPar1-7A versus wt hPar1.
A
i. Schematic representation of wt hPar1 and the mutant hPar1-7A. A
ii. The ectopic expression of hPar1-7A mutant construct abrogates binding of Etk/Bmx to PAR Stable clones of either HA-tagged wt hPar1 and/or a mutant construct of HA-hPar1-7A were activated and further analyzed for co-immunoprecipitation of PAR1 with Etk/Bmx. The IP was carried out using anti-HA (sc-7392; Santa Cruz, CA). The blots were detected by anti-Bmx (Transduction Laboratories, BD Biosciences, CA) for the identification of Etk/Bmx-associated PAR1. Levels of the HA-tag (for PAR1) are shown in the middle panel. Similarly, levels of PAR1 are also shown by application of anti- PAR1 (ATAP; Santa Cruz, CA) (lower panel). The right section shows levels of plasmid transfection efficiencies in the cells, as indicated by HA- PAR1 and Etk/Bmx analysis by western blots. As seen, only the wt hPar1 co-immunoprecipitated with Etk/Bmx (wt hPar1), while the mutant HA-hPar1-7A clone (mutant clone hPar1- 7A) failed to co-immunoprecipitate. This takes place under conditions whereby both constructs are well expressed, as evidenced by anti-HA-antibodies (western blot; right panel). B. Matrigel invasion assay of either MCF7 cells stably expressing HA-wt-hPar1and Etk/Bmx, or HA-hPar1-7A mutant and Etk/Bmx. Invading cells were counted and the mean ± SD of ten fields per filter was determined. Stable HA wt hPar1 clone or HA-hPar1-7A mutant clone were co-transfected with Etk/Bmx construct and TFLLRNPNDK-activated. Marked Matrigel invasion is seen in the wt hPar1 and Etk/Bmx clones. Low invasion levels are observed in the presence of hPar1-7A mutant and Etk/Bmx, hPar1 alone, empty vector, vector and Etk/Bmx or PAR1 antagonist. These data are representative of three experiments. C
i. Migration assay for wounding-scratch monolayer cells. MDA-MB-435 cell monolayer (expressing endogenous Etk/Bmx) were scratched to introduce an equal gap-area under the following conditions: control untreated cells, TFLLRNPNDK-activated or SiRNA-Etk/Bmx and TFLLRNPNDK-activated. In this set, rapid closure of the wound was obtained 24 hours under PAR1 activation as compared to control untreated cells. In contrast, no migration and closure of the wound was seen when the Etk/Bmx level of the cells were knocked down and they were TFLLRNPNDK-activated. In another set of wound introduction experiments, attenuated wound closure was seen in the presence of the V antagonist SCH79797 and SFLLR NPNDK PAR1 activation for 24 h, similar to the control untreated cells. These data are representative of four experiments. C
ii. RT-PCR analysis showing the level of Etk/Bmx in MDA-MB-435 cells before and after SiRNA- Etk/Bmx cell infection.Activated MCF7hPar1-7A mutant cells (also expressing Etk/Bmx) failed to invade Matrigel-coated membranes, as compared to a potent invasion level obtained by activated wt hPar1 (Fig. 7B).In a parallel experiment, a wound assay for the rate of cell migration, showing the ability of the cells to fill in gaps in an MDA-MB-435 cell monolayer, was performed. Rapid closure of the hPar1, but not HA-hPar1-7A, exhibited binding association with Etk/Bmx wound was observed following TFLLRNPNDK PAR1 activation. This PAR1 -induced cell migration was markedly inhibited when the cells were infected with siRNA-Etk/Bmx construct to knock down the endogenous Etk/Bmx levels present in MDA-MB-435 cells (Fig. 7C, top panel). Similar inhibition was obtained in the presence of the PAR1 antagonist, SCH 79797 (Fig. 7C, bottom panel), pointing to the important role of both PAR1 and Etk/Bmx in wound closure/migration of PAR1-activated MDA-MB-435 cells. The highly ordered tissue organization of normal epithelia is aggressively disrupted in pathological conditions. This is well recapitulated in the MCF10A cell-growth model, mimicking epithelia apico-basal polarity (24). We examined the morphogenesis of MCF10A mammary acini in three-dimensional (3-D) basement membrane cultures. Normal-appearing intact spheroids are formed in the presence of control Etk/Bmx-expressing MCF10A cells and activation by SFLLRNPNDK, a PAR1 agonist peptide (Fig. 8A; a, b). In contrast, in the presence of ectopically forced hPar1 (expressing also Etk/Bmx) and following PAR1 activation, an oncogene-like, migratory morphogenesis was obtained which was characterized by a complete loss of the cell-cell tight junction contacts and the invaded basement membrane architecture (Fig. 8A; c and g). Significantly, when the MCF10A cells (in the presence of endogenously expressed Etk/Bmx) were infected with the mutant cytoplasmic form of hPar1 (hPar1-7A) and SFLLRNPNDK PAR1 -activated, nearly normal-appearing spheroid morphology was obtained (Fig. 8A; d, f). This outcome highlights the fact that by preventing immobilization of Etk/Bmx on PAR1 C-tail, inhibition of invasion and lack of apico-basal polarity morphogenesis of an oncogene-like phenotype in MCF10A cells are observed.
Figure 8
Morphogenesis of MCF10A spheroids infected with either wt hPar1, mutant hPar1-7A or with Etk/Bmx maintained in 3-D Matrigel cultures.
A. Upper panel. Representative phase-contrast microscopic images of MCF10A cells under the following conditions: a. control untreated MCF10A. b. MCF10A cells infected with Etk/Bmx and SFLLRNPNDK PAR1 -activated. c. MCF10A cells infected with both wt hPar1 and Etk/Bmx and SFLLRNPNDK-activated. d. MCF10A cells infected with both mutant hPar1-7A and Etk/Bmx and SFLLRNPNDK-activated. Lower panel. Representative confocal microscopic images of MCF10A acini. e. Control untreated MCF10A, DAPI stained nuclei in a representative spheroid. f. MCF10A cells infected with both the mutant hPar1-7A and Etk/Bmx and SFLLRNPNDK-activated; DAPI staining of spheroid nuclei. g. MCF10A cells infected with both the wt hPar1 and Etk/Bmx and SFLLRNPNDK-activated; DAPI staining of the nuclei. h. MCF10A cells infected with both the mutant hPar1-7A and Etk/Bmx and SFLLRNPNDK-activated, stained for cell-cell contact with anti-E-cadherin. B. Schematic representation of MCF10A spheroid development in 3-D Matrigel cultures. C. RT-PCR analyses for the different MCF10A-infected cells. Levels of expression as compared to those of a house-keeping gene (GAPDH). A. MCF10A-infected wt hPar1 B. MCF10A infected with mutant hPar1-7A. C. Empty vector infected-MCF10A cells. D. Control, untreated MCF10A cells. E. MCF10A cells infected with Etk/Bmx.
Morphogenesis of MCF10A spheroids infected with either wt hPar1, mutant hPar1-7A or with Etk/Bmx maintained in 3-D Matrigel cultures.
A. Upper panel. Representative phase-contrast microscopic images of MCF10A cells under the following conditions: a. control untreated MCF10A. b. MCF10A cells infected with Etk/Bmx and SFLLRNPNDK PAR1 -activated. c. MCF10A cells infected with both wt hPar1 and Etk/Bmx and SFLLRNPNDK-activated. d. MCF10A cells infected with both mutant hPar1-7A and Etk/Bmx and SFLLRNPNDK-activated. Lower panel. Representative confocal microscopic images of MCF10A acini. e. Control untreated MCF10A, DAPI stained nuclei in a representative spheroid. f. MCF10A cells infected with both the mutant hPar1-7A and Etk/Bmx and SFLLRNPNDK-activated; DAPI staining of spheroid nuclei. g. MCF10A cells infected with both the wt hPar1 and Etk/Bmx and SFLLRNPNDK-activated; DAPI staining of the nuclei. h. MCF10A cells infected with both the mutant hPar1-7A and Etk/Bmx and SFLLRNPNDK-activated, stained for cell-cell contact with anti-E-cadherin. B. Schematic representation of MCF10A spheroid development in 3-D Matrigel cultures. C. RT-PCR analyses for the different MCF10A-infected cells. Levels of expression as compared to those of a house-keeping gene (GAPDH). A. MCF10A-infected wt hPar1 B. MCF10A infected with mutant hPar1-7A. C. Empty vector infected-MCF10A cells. D. Control, untreated MCF10A cells. E. MCF10A cells infected with Etk/Bmx.
Discussion
In the present study we characterized the contribution of PAR1 signaling events in breast cancer progression. We utilized constructs of hPar1, including wt hPar1 and either deleted or mutant hPar1 forms, and analyzed them for their ability to induce tumor development in mouse mammary gland and colorectal-liver metastasis models in vivo, as well as characterizing them biochemically in vitro. Injection of cells expressing wt hPar1 or Y397Z hPar1 into mouse mammary glands resulted in pronounced mammary tumor growth and angiogenesis. The truncated PAR1 construct, however, which lacked the cytoplasmic tail, was incapable of promoting PAR1 -induced tumors in vivo. These findings emphasize the pivotal role of the cytoplasmic tail in PAR1 function. Antibody-array analyses for the detection of signaling partners that bind to PAR1 revealed the involvement of Shc and Etk/Bmx, among others. We describe herein a novel signaling complex formed between Etk/Bmx and Shc assembled onto the PAR1 C-tail, thus providing a central docking site to facilitate tumor progression, invasion and angiogenesis.Studies of Par1-deficientmice revealed a critical role for PAR1 in blood vessel formation [13]. PAR1 induces tumor angiogenesis via the up-regulation of at least VEGF and Gro oncogenes (27,28). Furthermore, hPar1 gene withdrawal leads to the selective regression of immature but not mature blood vessels [21]. We show here that tumors generated by either wt hPar1 or persistent Y397Z hPar1 are capable of inducing marked vascularization, as compared to only a few blood vessels formed by the truncated hPar1-induced tumors. Together, these results emphasize a central role for PAR1 expression and signaling in tumor progression.A critical role for Etk/Bmx and Shc was demonstrated by their selective recruitment to activated PAR1 C-tail. Moreover, the prime event of Etk/Bmx binding is a prerequisite for further PAR1-Shc association. We demonstrate herewith the hierarchy and sequence of events during PAR1 signaling in breast cancer progression. While PAR1-induced Shc phosphorylation has been previously reported [14], [22], [23], we provide here the first evidence for a physical association between Shc and PAR1. Substitution of tyrosine residues in PAR1 C-tail by alanine did not abrogate the recruitment of Shc to PAR1 tail, indicating that PAR1tyrosine residues are not involved in the direct association between PAR1 and Shc. Furthermore, the mutant Y381A showed enhanced metastatic capabilities when compared to wt hPar1 in a colorectal-liver metastasis animal model. This implies that the Y/A substitution (Y381A) most likely endows PAR1 with better accessibility to essential signaling proteins and thereby enables enhanced metastasis (a hypothesis that is currently under investigation). The fact that the tyrosine residues in PAR1 C-tail do not play a role in the binding of Shc implies the requirement of a third mediating partner. Indeed, Etk/Bmx binding to PAR1 C-tail through the PH-domain is required for PAR1 -Shc association. One cannot, however, exclude the possibility that Bmx binds first to Shc and only then does the complex of Etk/Bmx-Shc bind to PAR1.The fact that we have obtained tumors in vivo following implantation of either MCF7 cells over-expressing wt hPar1, or Y397Z hPar1 in the mammary fat pads of mice (Fig. 1), raises the issue as to the significance of Etk/Bmx in vivo. When we have immunostained for Etk/Bmx, xenograft sections derived from the tumors obtained of MCF7 cells over-expressing these constructs, abundant and high levels of Etk/Bmx was found in tumors generated by MCF7/wt hPar1 and MCF7/Y397Z hPar1. In-contrast, no Etk/Bmx was seen in either MCF7/empty vector or MCF7/truncated hPar1small tumors (see Figure S5). This finding recapitulates the presence of Etk/Bmx in tumors generated by MCF7 cells over-expressing hPar1, in vivo in a manner that remains to be fully explored. One attractive possibility is that environmental cues in-vivo are responsible for the expression of Etk/Bmx in PAR1-derived tumors. It is plausible that the very low endogenous levels of Etk/Bmx originally present in MCF7 cells are markedly induced in vivo, due to micro environmental signals (in a yet unknown manner).The recruitment of Etk/Bmx and Shc to PAR1 C-tail provides a bridge linking PAR1 with receptor tyrosine kinases (RTKs) and associated downstream signaling pathways. For example, the proto-oncogene Src plays a pivotal role in integrin activation during tumor progression [24]. While the C-terminal Src kinase consists of SH3, SH2 and kinase domains, it may be recruited to a phosphorylated site in Etk/Bmx (following PAR1 activation; see Fig. 3A) via the SH2 domain. This scaffold assembly of PAR1 -Etk/Bmx-Shc and Src complex formation remains to be fully elucidated.Whereas Etk has been shown to mediate integrin signaling by binding to the FAK FERM domain through the Etk PH domain [25], activation of PAR1 has also been shown to induce FAK phosphorylation and integrin signaling via cross talk with αvβ5 integrin [26]. However, it is not known how PAR1 activation leads to αvβ5 integrin activation and FAK phosphorylation. While, in breast cancer, activated PAR1 is engaged in binding Etk/Bmx via the PH domain, thus occupying this site, it is plausible that the Pro-712/713 proline-rich region of FAK (e.g., Pro-X-X-Pro-X-Arg) associates with the SH3 domain present in Etk/Bmx, connecting PAR1 to integrins via FAK association to Etk/Bmx. This possibility needs to be fully explored. It has also been demonstrated that the docking protein p130Cas forms a complex with Etk/Bmx. This protein plays a role in the formation of focal adhesion complex sites, the regulation of actin cytoskeleton reorganization and cell migration. Since Cas undergoes tyrosine phosphorylation prior to complex formation, it is feasible that phosphorylated p130Cas associates with the SH2 domain of PAR1 -C-tail immobilized Etk/Bmx [27].PAR1 induces activation of the small GTPase RhoA, which participates in formation of focal adhesions and in regulating the reorganization of the actin cytoskeleton. It was suggested that Etk/Bmx activates Rho A by releasing the GDI from the inactive RhoA-GDI complex through the interaction with Etk/Bmx PH domain [28]. Perhaps a balance is obtained between the free Etk/Bmx-PH domain in activating RhoA and the PAR1-C-tail immobilized Etk/Bmx-PH domain, in the delicate control of cytokeletal reorganization and actin stress fiber formation during breast cancer progression.Akt/PKB, first identified as the cellular homologue of the transforming oncogene v-Akt
[29], is a core component of the phosphoinositide 3-kinase (PI3K) signaling pathway and effectively promotes cancer cell survival and proliferation. Activation of PI3K may be mediated via association of the SH2 domain in one of the two (85 kDa and 110 kDa) PI3K domains (most likely p85) with phosphorylated tyrosine residues in Etk/Bmx, following PAR1 activation. This leads to the recruitment of PI3K to the cell membrane and ultimately to activation of the serine/threonine kinase Akt, an immediate downstream target acting to promote breast cancer survival.Shc in the complex (PAR1 -Etk/Bmx-Shc) may recruit the Grb2 (growth factor-bound protein-2)-SOS (Son of sevenless) complex to the membrane via binding of the SH2 domain of Grb2 to the phosphotyrosine on Shc. SOS, a GEF for Ras, can then exchange the GDP bound to Ras GTP. Once Ras binds GTP, it is then activated, leading to the ERK activation cascade.Increasing evidence suggests that the Btk kinase family plays a central role in various cellular processes [18]. Recently, Bmxtransgenic mice were demonstrated to exhibit skin hyperplasia, inflammatory cell recruitment and strong dermal angiogenesis, as well as accelerated wound healing [30]. In agreement with these transgenic animal characteristics, Etk/Bmx was shown to interact physically with a vast number of proteins, among them FAK [25], Src
[31], G-proteins [32], [33], [34], STAT3[19] and P21[35]. We found that Etk/Bmx kinase is phosphorylated following PAR1 activation (see Fig. 3A), suggesting that kinase activation is important for the downstream signaling of PAR1. A seven-amino-acid sequence region in the PAR1 C-tail portion was identified as the site required for association with the Etk/Bmx-PH domain. Part of this region, located in the 8th helix region, as revealed by the X-ray structure of rhodopsin, was previously reported to be significant for platelet PAR1 activation [36].PAR1 C-tail is a highly conserved region among species, implying the importance of this region in protein-protein interaction and signaling. Stable MCF7 clones expressing both wt hPar1 and Etk/Bmx exhibit enhanced invasion properties potently inhibited by a PAR1 -specific antagonist. In contrast, low levels of invasion are shown by stable MCF7 clones of Etk/Bmx and hPar1-7A mutants. Similar data, further supporting the importance of Etk/Bmx in PAR1 -induced migration, is demonstrated by wound-gap closure in cell monolayers. The key role of Etk/Bmx is also shown in the nearly normal acinar structure of MCF10A cell cultures maintained in a three-dimensional (3-D) environment in vitro. This 3-D cell culture mimics large, epithelial tissues in vivo, in the context of apico-basal polarized structure. The ectopic forcing of wt hPar1 in MCF10A cells, followed by activation, results in dramatic altered structures of disrupted tight-junction contacts, complete loss of cell polarity and extensive protrusions of invaded basement membranes. Blocking Etk/Bmx binding to PAR1 by over-expressing hPar1-7A mutant in MCF10A cells maintained in 3-D basement membrane cultures abrogates the oncogene-like phenotype. Instead, nearly ball-shaped spheroids of apico-basal polarization are obtained. This outcome strongly supports a fundamental role for Etk/Bmx in PAR1 -induced invasion. Our data contribute to a list of Etk/Bmx counter-partners, such as TNF, that mediate angiogenesis via binding to a 16-amino-acid sequence of TNFR2, which binds to multiple Etk/Bmx binding domains (PH, TEC and SH2) [37]. Similarly, the Etk-PH-domain has been shown to regulate integrin signaling, and promote cell migration through the specific association of FAK via the FERM domain [25]. In addition, Etk/Bmx immobilized to PAR1 C-tail may provide a central junction site for possible cross-talk between PAR1 and EGFR, as well as ErbB2/HER2, following PAR1 activation [38].Our study identifies essential signaling partners in PAR1 -mediated breast cancer progression, determines the hierarchy of binding and identifies a critical associating region in the PAR1 C-tail. This is the first demonstration of the PAR1 C-terminus serving as a scaffold tail. The identification of a PAR1 C-tail binding domain may provide a platform for new therapeutic vehicles in the treatment of breast cancer.
Materials and Methods
Cell culture
MCF7 and MDA-MB-435humanbreast carcinoma, CT-26mousecolon carcinoma, HEK-293 cells and the African green monkey kidney fibroblast cell line COS1 (these cell lines were obtained from the ATCC, VA, USA) were maintained in DMEM with 10% fetal calf serum. Stable clonal cell lines over-expressing wt hPar1, Y397Z hPar1, truncated hPar1 and Y/A mutants; Yor the wt-Etk and Etk-KQ were selected for G418 resistance (800 µg/ml).
Plasmids and transfection
MCF7 cells were transfected with 1–2 µg of either wt humanhPar1 or truncated hPar1 or Y397Z hPar1 cDNA, or with a control pcDNA3 vector (Invitrogen, Carlsbad, CA) using FuGene transfection reagent (Roche Molecular Biochemicals, Indianapolis, IN). Transfected cells were selected with G418 (800 µg/ml) to obtain stable populations of cells expressing hPar1 and the variants. Etk/Bmx plasmids (e.g., wt, kinase-dead, KQ and GST-PH-Etk/Bmx) [18], [19] were transfected into HEK-293 cells using the same protocol as previously described.
RNA isolation and RT-PCR
RNA was isolated with Tri-Reagent (MRC, Cincinnati, OH) according to the manufacturer's instructions. After reverse transcription of 1 µg total RNA by oligo (dT) priming, cDNA was amplified using Taq DNA polymerase (Promega, Madison, WI). Comparative semi-quantitative PCR was performed using the following primers: GAPDH sense: 5'-CCA CCC ATG GCA AAT TCC ATG GC-3' and antisense: 5'-TCT AGA CGG CAG GTC AGG TCC ACC-3' primers. PAR1 N-terminus primers were as follows: hPar1-sense: 5′- CTCGTCCTCAAGGAGCAAAC-3′, antisense orientation: 5′-TGGGATCGGAACTTTCTTTG-3'.(resulting with a 564-bp PCR product). PAR1 C-tail primers - sense: 5′-TAC TAT TAC GCT GGA TCC TCT GAG-3′ and antisense: 5′-CTT GAA TTC CTA AGT TAA CAGCTT-3′. These primers give rise to a 181-bp product corresponding to the entire PAR1 C-tail site, as follows:YY - YASSECQRYVYSILCCKESSDPSYNSSGQLMASKMDTCSSNLNNSIYKKLLT.
Animal studies: Mammary gland model
Female athymic nude mice at 6–8 weeks of age were pre-implanted subcutaneously with pellets containing 1.7 mg β-estradiol (60-day release, Innovative Research of America, Sarasota, FL). Mouse mammary pads were then injected with 1×107 MCF-7 cells stably transfected with hPar1 wt and mutant constructs (e.g., wt, Y397Z and truncated) or pcDNA3 control plasmid. Mice were monitored for tumor size by external caliber measurements (length and width) on days 10, 22, 25, 29, 33, 36 and 45. Tumor volume (V) was calculated by V = L×W2×0.5, where L is length and W is width. On day 45, mice were sacrificed and tumors were removed, weighed and fixed in formalin for histology. All animal experiments were approved by the animal committee of the Hebrew University, Jerusalem, Israel (MD-107.05-4).
Liver metastasis model
CT-26mousecolon carcinoma cells were stably transfected with either wt hPar1 or hPar1-Y constructs. The activation of PAR1 (using the peptide SFLLRN) was performed prior to injection into the mice. CB6F1 mice were anesthetized (75 mg/kg ketamine +3 mg/kg xylazine, i.p.), and the spleen was exteriorized through an incision (1.0 cm) on the left side of the mouse. CT-26 cells (104 cells/mouse) transfected with the different constructs (e.g., hPar1, hPar1Y381A, mock-transfected vector) were injected into the spleen using a 30-gauge needle. The cell suspension was allowed to enter the portal circulation over a short period (5 minutes), after which the spleen was removed, as previously described [39]. The wound was sutured and the animal was allowed to recover. MRI images were monitored every 2–3 days on a 4.7T Bruker Biospec spectrometer using a bird-cage coil. Tumor assessment was made by serial coronal and axial T2W fast SE images (TR/TE = 2000/40 ms). All experiments were performed in accordance with the guidelines of the Animal Care and Use Committee of the Hebrew University, Jerusalem, Israel (MD-107.05-4).
PAR1 activation
PAR1 was activated by the SFLLRN (H-Ser-Phe-Leu-Leu-Arg-Asn-NH2) peptide, the TFLLRNPNDK peptide, a selective PAR1 agonist, or thrombin (1 U/ml).
Histology
Tissue samples derived from the primary tumors were fixed with 4% formaldehyde in PBS, embedded in paraffin and sectioned (5-µm sections). After de-paraffinization and re hydration, sections were stained with hematoxylin and eosin (H&E) or subjected to immunohistochemistry using specific antibodies.
Histological evaluation and scoring
The combined histological results were assessed and scored as previously described[40], [41]. The measurements per slide section was carried out using anatomical compartments, using an ocular micrometer (WHIOX2, Olympus, New Jersey, USA). Slides review was independently performed by two investigators (BM and RB). Discrepancies were resolved by simultaneous re-examination of the slides by both investigators using a double-headed microscope. The microscope was calibrated with a micrometer slide before each measurement. All measurements were performed on the monitor screen using a ×40 objective. On examining the sections for selection of fields tumor cells from the most cellular area at the center of the tumor were selected. Necrotic and inflammatory area were avoided. Eight microscopic fields were screened, 10 cells/field were selected and no less than 50 cells/tumor case were assessed. The positive rate of staining is expressed as a mean ± SD per tumor histological subtype from selected cases.
Immunohistochemistry
Sections were subjected to inactivation of endogenous peroxidase (3% H2O2 in DDW), antigen retrieval by microwave oven (3 min) in citrate buffer (0.01 M, pH 6.0), and blocking with 10% goat serum in PBS. Sections were then incubated with antibodies directed against Von-Willebrand factor (anti-factor VIII, DAKO, Carpinteria, CA), Ki-67 (Clone SP6, Lab Vision-NeoMarkers, Fremont, CA), or an endothelial cell-specific lectin (Bandeiraea simplicifolia BS-1 isolation) [42], followed by incubation with horseradish peroxidase-conjugated anti-rabbit antibody (DAKO, Carpinteria, CA). Color was developed by incubation (10 min) with the Zymed AEC substrate kit (Zymed Laboratories, South San Francisco, CA), and counterstained with Mayer's hematoxylin.
Preparation of hPar1 constructs: truncated hPar1, Y397Z hPar1, Y and Y
Detection of hPar1 was carried out using primers: sense orientation: 5′- CTCGTCCTCAAGGAGCAAAC-3′, antisense orientation: 5′-TGGGATCGGAACTTTCTTTG-3'. For the PAR1 -C-tail primers: sense orientation: 5′ -TACTATTACGCTGGATCCTCTGAG-3′, antisense: 5′- CTTGAATTCCTAAGTTAACAGCTT-3′. These primers give rise to a 181-bp product corresponding to the entire PAR1 C-tail site, as follows:YY - YASSECQRYVYSILCCKESSDPSYNSSGQLMASKMDTCSSNLNNSIYKKLLTUsing polymerase chain reaction, we constructed a PAR-1 mutant protein truncated in its cytoplasmic tail after amino acid leucine 369 or at tyrosine 397. Truncated hPar1 at residue 369 was designed as described in [14]. Y397Z construct: PAR-1 cDNA served as a template for amplifying the fragment containing STOP codon using the followed primers: sense: 5'-ATA AGC ATT GAC CGG TTT CTG-3' and antisense: 5'-GCT CTA GAT TTT AAC TGC TGG GAT CGG AAC-3'. Replacement of tyrosine residues at PAR1 cytoplasmic tail was achieved using specific primers containing the point mutation. Primer sequences were as follows: 381-sense: 5'-TGC CAG AGG GCT GTC TAC AGT ATC TTA TGC-3', 381-antisense: 5'- GAT ACT GTA GAC AGC CCT CTG GCA CTC AGA-3', 383-sense: 5'-GCC AGA GGT ACG TCG CAA GTA TCT TAT GCT GCA AA-3', 383-antisense: 5'-AAG ATA CTT GCG ACG TAC CTC TGG CAC TCA G-3'. The amplified DNA fragment was digested with XbaI and HindIII from PAR1 cDNA and cloned into a pcDNA3 plasmid, followed by DNA sequencing. To confirm the functional integrity of the DNA constructs, wt and mutant cDNAs were transiently expressed in COS-1 cells that were subsequently subjected to FACS analysis with a PAR-1-specific antibody (WEDE15-PE, Immunotech, Cedex, France).
HA-tag wt hPar1 and HA-mutant hPar1-7A C-tail constructs
The mutants were designed for insertion of A at the carboxy terminus of PAR1 residues 378–384: SSEILCCKESS to SSEAAAAAAAILCC (named hPar1-7A mutant). For HA-tag wt hPar1 construct PCR primers were designed and added downstream to the ATG start codon. Primers for the HA-tag are as follows: sense: 5'- TAC CCA TAC GAT GTT CCA GAT TAC GCT-3' and anti-sense: 5′-AGC GTA ATC TGG AAC ATC TA TGG GTA-3′. Replacement of seven residues with Ala (A) at positions 378–384 was made by synthesis of oligos containing the mutation. Primer sequences were as follows: hPar1 7A mutant: sense: 5'- TCT GAG and anti-sens:e 5'- TAA GAT AGC TGC AGC AGC AGC AGC AGC CTC AGA -3'. PCR products were then used as primers on an hPar1 cDNA template to create an extended product of introduced mutations into the full-length sequence. The amplified DNA fragment was digested with PinAI and XbaI from PAR1 cDNA and cloned into pcDNA3-hPar1 plasmid followed by DNA sequencing.
GST-C-tail cloning
GST-C-tail of PAR1 fragment, containing 54 amino acids from serine 369 to residue 425, was prepared using RT-PCR (5′-TAC TAT TAC GCT GGA TCC TCT GAG-3′ and 5′-CTG AAT TCC TAA GTT AAC AGC TT-3′). The resulting DNA fragment was further cut with the appropriate restriction enzymes (BamH1 and EcoR1) and ligated into pGEX2T vector. The GST-C-tail was separated by SDS-PAGE, which indicated that the fusion protein of the C-tail was adequately prepared. The molecular weight of GST protein is 27 kD and the GST-C tail fusion protein is 32 kD. GST-Shc-SH2 and tandem SH2 were kindly provided by S. Katzav, Hubert H. Humphrey Center for Experimental Medicine and Cancer Research, Hebrew University-Hadassah Medical School, Jerusalem.
GST fusion protein columns
Fusion proteins were purified from transformed Escherichia coli bacteria that had been stimulated with isopropyl-β-D-thio-galactopyranoside (IPTG) at a concentration of 0.3 µM. Bacteria were lysed according to published procedures, and then immobilized on glutathioneSepharose beads (Pharmacia). Briefly, MDA-MB-435 cell lysates were applied to GST- PAR1 C-tail or GST control columns. After 2 h binding periods to the designated protein/s cell lysates to the columns, a washing step was performed. The washes (×3) were carried out using a “wash buffer” including: 100 mM NaCL, 20 mM EDTA, 10 mM Tris, pH 8.0 and 1% Triton x100. This step was performed in order to wash out all non-specific proteins, leaving the GST- PAR1 -C-tail column firmly bound to targeted cell lysate proteins. Next, elution of bound proteins was performed via the addition of gel “sample buffer” and appropriate boiling. The samples were run electrophoretically on SDS-PAGE gels, followed by immunoblotting with the indicated antibodies and ECL detection.
GST-PH-Etk/Bmx
The PH domain in Etk/Bmx was bound to GST column as previously described[25].
Purification of PAR1 C-tail fragments
PAR1 C-tail fragments were generated using a “thrombin cleavage capture kit” (Novagen, Madison, WI; Cat no. 69022-3). The enzyme used for the cleavage was biotinylated humanthrombin. Briefly, the cleavage was performed according to the manufacturer instructions. Biotinylated thrombin was removed from the cleavage reaction using streptavidin agarose beads, and the cleaved peptides (e.g., wt PAR1 -C-tail and Y381AC-tail) were isolated and loaded on a GST-Etk-PH column. After incubation for 4 h the purified fragments were applied onto the GST-PH-Etk/Bmx column and detected following gel separation and western blotting analysis using anti- PAR1 antibodies (ATAP, Santa Cruz, CA).
Flow Cytometry Analysis
To activate PAR1, thrombin (1 U/ml was added for 5 min. The cells were detached from the plates with 0.5 mM EDTA in 0.1 M sodium phosphate at pH 7.4 (Biological Industries), washed and re-suspended in PBS. The cells were analyzed by FACS after incubation for 60 min at 4°C with 10 µg/ml anti- PAR1 -wede-PE antibodies.
Western blot and immunoprecipitation analysis
Cells were activated with agonist peptide TFLLRNPNDK for the indicated periods of time and solubilized in lysis buffer containing10 mM Tris-HCl, pH 7.4, 150 mM NaCl, 1 mM EDTA, 1% TritonX-100, and protease inhibitors (5 mg/ml aprotinin, 1 mM phenylmethylsulfonylfluoride, and 10 mg/ml leupeptin) at 4°C for 30 min. The cell lysates were subjected to centrifugation at 12,000 rpm at 4°C for 20 min. We used 400 µg of the supernatants with anti- PAR1 (ATAP, Santa Cruz, CA 1 µg), anti-HA (anti-HA sc-7392; Santa Cruz, CA), anti-Shc or Etk/Bmx antibodies (10 µg/ml). After overnight incubation, Protein A-Sepharose beads (Amersham Pharmacia Biotech, Buckinghamshire, UK) were added to the suspension (50 µl), which was rotated at 4°C for 1 h. The immunocomplexes were eluted and run electrophoretically on a 10% SDS-PAGE gel, followed by transfer to an Immobilon-P membrane (Millipore). Membranes were blocked and probed with 1 µg/ml amounts of the appropriate antibodies as follows: anti- PAR1thrombin receptor mAb, (ATAP, from Santa Cruz, 1∶1000); anti-Shc (BD, 1∶2000); anti-Bmx (Transduction Laboratories, 1∶1000) or anti-PY (Upstate 4G10, 1∶2500), suspended in 3% BSA in 10 mM Tris-HCl, pH 7.5, 100 mM NaCl, and 0.5% Tween-20. After washes the blots were incubated with secondary antibodies conjugated to horseradish-peroxidase. Immunoreactive bands were detected by enhanced chemiluminescence (ECL). Membranes were stripped and incubated with anti-IP antibodies to ensure equal protein load.Anti- PAR1 polyclonal antibodies were generated using two regions of the N-terminus portion R/SFFLRN by the synthetic peptides NH2-CLLRNPNDKYEPFWED-COOH and NH2-KSSPLQKQLPAFISC-COOH.
Antibody array
A custom-made antibody array (hypromatrix) containing thirty antibodies against suspected proteins was prepared (see Fig. S2). The antibodies were immobilized on a membrane, each at a pre-determined position, and they retained their capabilities of recognizing and capturing antigens as well as antigen-associated proteins. MDA-MB-435 cells were activated for 10 min with thrombin (1 U/ml). Untreated or activated cells were lysed with Triton extraction solution: 15 mM Tris, pH 7.5, 120 mM NaCl, 25 mM KCl, 2 mM EGTA, 2 mM EDTA, 0.1 mM DTT, 0.5% Triton X-100, 10 µg/ml leupeptin and 0.5 mM PMSF. Protein extract was incubated on pre-blocked membrane for 2 h at room temperature. The antibody array was washed with TBST and incubated with biotinylated PAR1 antibody (ATAP) for 2 h at room temperature. The antibody array was washed again with TBST, and the membrane was incubated with HRP-conjugated streptavidin for 1 h. Protein-protein interactions were detected by ECL and exposure to X-ray film.
Matrigel invasion assay
Blind-well chemotaxis chambers with 13-mm diameter filters were used for this assay. Polyvinylpyrrolidone-free polycarbonate filters, 8 mm pore size (Costar Scientific Co., Cambridge, MA), were coated with basement membrane Matrigel (25 µg/filter), as previously described [43]. Briefly, the Matrigel was diluted to the desired final concentration with cold distilled water, applied to the filters, and dried under a hood. Cells (2×105) suspended in DMEM containing 0.1% bovine serum albumin were added to the upper chamber. Conditioned medium of 3T3 fibroblasts was applied as a chemo-attractant and placed in the lower compartment of the Boyden chamber. Cells were incubated for 18 h on filters at 37°C in 5% CO2. At the end of the incubation, cells on the upper surface of the filter were removed by wiping with a cotton swab. The filters were fixed and stained with DifQuick System (Dade Behring Inc., Newark, NJ). Ten fields were chosen from the lower surface of the filter and cells within each field were counted. The mean +/− SD of the ten fields was calculated for each filter. Each assay was performed in triplicate.
MCF10A morphogenesis assay
The assay was performed as previously described (24). In brief, while the MCF10A cells were maintained in DMEM/F12 medium with 20% donorhorse serum, the cells for spheroid assay (DMEM/F12 supplemented with 2% donorhorse serum, 10 µg/ml insulin, 1 ng/ml cholera-toxin, 100 µg/ml hydrocortisone, 50 U/ml penicillin and 50 µg/ml streptomycin) were resuspended at a concentration of 105 cells per 4.0 ml. Eight-chambered RS glass slides (Nalgene) were coated with 35 µl Matrigel per well and left to solidify for 15 min. The cells were mixed 1∶1 with assay medium containing 4% Matrigel and 10 ng/ml EGF, and 400 µl were added to each chamber of the Matrigel-coated eight-chambered slide. Assay medium containing SFLLRNPNDK PAR1 activation peptide and 5 ng/ml EGF was replaced every 4 days. The images were taken between days 8–12. In the representative experiment shown images were taken on day 10. The media and supplements were replaced every 4 days and thus, the activating peptide was added fresh to the medium every 4 days.Surface expression of various hPar1 constructs (e.g., deletion constructs and Y/A mutations) following ectopic insertion to MCF7 cells. A. PAR1 constructs (e.g., wt, deleted constructs and Y/A mutations). Schematic representation of hPar1 deletion constructs derived from human PAR1 cDNA. Mutations of Y/A insertions of the functional relevant Y residues in PAR1 C-tail (e.g., Y381AhPar1 and the double mutant Y381A & Y383AhPar1) whereby replacement of Y/A at positions 381 and 383 of PAR1 C-tail was performed. B. FACS (fluorescent activated cell sorter) analysis. Flow cytometric analysis of surface-expressed wt hPar1, hPar1 deletion constructs, Y381AhPar1 and the double mutant Y381A & Y383AhPar1. Constructs were transiently expressed in COS-1 cells and surface expression was determined by flow cytometry analysis using anti-PAR1 abs (WEDE-PE 2584, Immunotech), directed to detect cell surface levels of PAR1 (analyses performed on intact cells). Empty peak - represents the isotype control antibody alone; black peak - represents PAR1 antibody. C. Histograms representing the surface expression of wt, deleted and mutant hPar1 constructs before and after activation. Surface expression levels of the various hPar1 constructs (e.g., wt hPar1, truncated hPar1, Y397Z hPar1, Y381AhPar1 and Y381A & Y383AhPar1) transfected into COS-1 cells were determined. The various COS-1 transfected cells were evaluated by FACS analysis before (open bars) and after (black bars) a 30-minute activation with thrombin. Similar results were obtained in MCF7 cells expressing the hPar1 various constructs (data not shown). D. PAR1 expression levels in MCF7 cells transfected with various hPar1 constructs. Western blot analysis of MCF7 cells expressing either empty vector (A) or Y397Z hPar1 (B), truncated hPar1 (C), the double mutant Y381A & Y383AhPar1(D), Y381AhPar1 (E), as also wt hPar1 (F). Levels of protein loading were evaluated by b-actin.(4.60 MB TIF)Click here for additional data file.Antibody-array of protein-protein interactions and physical association between PAR1 and the signaling partner Etk/Bmx. A. Custom-made antibody array. Table lists antibodies embedded on membranes showing the orientation map to create the custom array, as described in Materials and Methods. B. Lysates of MDA-435 cells before (i) and after (ii)thrombin (1 U/ml, 15 min) activation were applied to the membranes. Specific PAR-1 binding to the array was detected via incubation with biotinylated anti-PAR1 antibodies.(4.60 MB TIF)Click here for additional data file.The phosphorylation status of Etk/Bmx associated PAR1 following PAR1 activation. Ai. HEK-293 cells were transfected with either wt Etk/Bmx or inactive KQ kinase -Etk/Bmx. Lysates were immunoprecipitated with anti Bmx and western blotted with 4G10 abs to detect levels of phosphorylation. Western blot analysis shows the levels of either endogenous Etk/Bmx (lanes c & d) or ectopically enforced Etk/Bmx (a & b) as compared to a house keeping gene b-actin. Aii. Endogenous levels of Etk/Bmx in HEK-293 cells. Western blot analysis was performed in lysates of HEK-293 cells before (c,d) and after (a,b) transfection with Etk/Bmx constructs. The equal loading levels were determined by a house keeping b-actin protein levels. B. PAR1-Bmx association. MDA-435 cells were TFLLRNPNDK-activated. Lysates were co-immunoprecipitated with anti-PAR1 antibodies, and eluted proteins were detected with Bmx antibodies. A strong association between PAR1 and Etk/Bmx was observed as early as 1 minute after activation reaching maximal levels after 10 minutes.(2.05 MB TIF)Click here for additional data file.Characterization of MCF7 clones of HA-tagged wt and mutants of hPar1 constructs. A. FACS analysis of MCF7 clones. Surface expression of HA-wt hPar1 and HA-hPar1-7A, was determined by using anti-PAR1 abs (WEDE-PE 2584, Immunotech). Empty peak - represents the isotype control antibody alone; black peak - represents PAR1 antibody. B. Histogram representing surface levels of the constructs (e.g., HA-wt hPar1 and HA-hPar1 7A) as determined by FACS analysis. C. Western blot analysis of MCF7 cells transfected with empty vector and representative MCF7 clones (e.g., HA-wt hPar1 and HA-hPar1-7A). The protein levels are compared to a house keeping of b-actin protein levels.(2.05 MB TIF)Click here for additional data file.Immuno histological staining of Etk/Bmx in sections of mouse mammary tumor xenografts generated following implantation of MCF7 cells expressing wt hPar1 and variant constructs. MCF7 cells expressing various hPar1 forms (e.g., wt hPar1, truncated hPar1, Y397Z hPar1 and empty vector) were inoculated into the mammary fat pads of mice. After 45 days the tumors were excised and embedded with paraffine. Antibodies directed against Etk/Bmx (Transduction Laboratories; BD Biosciences, California) were applied on sections derived from each of the designated treatment. The right panel represents staining in the absence of anti Etk/Bmx antibodies and presence of a secondary antibody - only (for controls). As one can note, specific Etk/Bmx staining is observed in wt hPar1 and particularly strong staining is noticed in Y397Z hPar1 (Mag ×200). No staining is observed in either the truncated hPar1 or empty vector sections. This staining is a representative experiment of three times staining experiments performed on these mice mammary xenograft sections.(2.05 MB TIF)Click here for additional data file.
Authors: S C Even-Ram; M Maoz; E Pokroy; R Reich; B Z Katz; P Gutwein; P Altevogt; R Bar-Shavit Journal: J Biol Chem Date: 2001-01-26 Impact factor: 5.157
Authors: R Bagheri-Yarmand; M Mandal; A H Taludker; R A Wang; R K Vadlamudi; H J Kung; R Kumar Journal: J Biol Chem Date: 2001-05-29 Impact factor: 5.157
Authors: Dennis Jones; Zhe Xu; Haifeng Zhang; Yun He; Martin S Kluger; Hong Chen; Wang Min Journal: Arterioscler Thromb Vasc Biol Date: 2010-09-23 Impact factor: 8.311
Authors: G N Adams; B K Sharma; L Rosenfeldt; M Frederick; M J Flick; D P Witte; L O Mosnier; E Harmel-Laws; K A Steinbrecher; J S Palumbo Journal: J Thromb Haemost Date: 2018-09-27 Impact factor: 5.824
Authors: Zhao Li; Mingzhu Yin; Haifeng Zhang; Weiming Ni; Richard W Pierce; Huanjiao Jenny Zhou; Wang Min Journal: Circ Res Date: 2020-01-08 Impact factor: 17.367
Authors: Amee J George; Brooke W Purdue; Cathryn M Gould; Daniel W Thomas; Yanny Handoko; Hongwei Qian; Gregory A Quaife-Ryan; Kylie A Morgan; Kaylene J Simpson; Walter G Thomas; Ross D Hannan Journal: J Cell Sci Date: 2013-09-17 Impact factor: 5.285
Authors: Tanja Holopainen; Markus Räsänen; Andrey Anisimov; Tomi Tuomainen; Wei Zheng; Denis Tvorogov; Juha J Hulmi; Leif C Andersson; Bruno Cenni; Pasi Tavi; Eero Mervaala; Riikka Kivelä; Kari Alitalo Journal: Proc Natl Acad Sci U S A Date: 2015-10-01 Impact factor: 11.205