| Literature DB >> 18295522 |
Zhigang Liu1, Huan Liu, Xiaoyu Liu, Xuli Wu.
Abstract
A novel antimicrobial peptide named as ixosin-B was isolated from the salivary glands of the hard tick, Ixodes sinensis, by gel filtration, ion exchange chromatography and reverse-phase high-performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined as QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY by Edman degradation. The cDNA encoding ixosin-B was cloned by cDNA library screening. The predicted protein from the cDNA sequence composed of 89 amino acids including mature ixosin-B. Purified ixosin-B exerted its antimicrobial activities against bacteria and fungi. No similarity was found by BLAST search to any database entries and, thus, our findings describe a novel antimicrobial peptide. It is also the fourth family of antimicrobial peptide from hard ticks.Entities:
Mesh：
Substances：
Year: 2007 PMID： 18295522 DOI： 10.1016/j.cbpb.2007.10.002
Source DB: PubMed Journal: Comp Biochem Physiol B Biochem Mol Biol ISSN： 1096-4959 Impact factor: 2.231