Literature DB >> 1663363

Characterization of a diuretic peptide from Locusta migratoria.

I Kay1, C H Wheeler, G M Coast, N F Totty, O Cusinato, M Patel, G J Goldsworthy.   

Abstract

A diuretic peptide Locusta-DP, identified by its ability to increase cyclic AMP production in locust Malpighian tubules in vitro, has been isolated and characterized from whole heads of Locusta migratoria. The purified peptide stimulates fluid secretion by Malpighian tubules maximally in vitro. The primary structure of Locusta-DP was established as a 46 residue amidated peptide: MGMGPSLSIVNPMDVLRQRLLLEIARRRLRDAEEQIKANKDFLQQI-NH2. Locusta-DP has 48% sequence identity with Acheta-DP and 49% identity with Manduca-DH, and provides further evidence for the presence of a family of diuretic peptides in insects.

Entities:  

Mesh：

Substances：

Year:  1991        PMID： 1663363     DOI： 10.1515/bchm3.1991.372.2.929

Source DB:  PubMed          Journal:  Biol Chem Hoppe Seyler        ISSN： 0177-3593


  8 in total

Review 1.  Neuropeptides in the insect brain: a review.

Authors:  D R Nässel
Journal:  Cell Tissue Res       Date:  1993-07       Impact factor: 5.249

2.  Cockroach diuretic hormones: characterization of a calcitonin-like peptide in insects.

Authors:  K Furuya; R J Milchak; K M Schegg; J Zhang; S S Tobe; G M Coast; D A Schooley
Journal:  Proc Natl Acad Sci U S A       Date:  2000-06-06       Impact factor: 11.205

3.  Characterization of the precursor for Manduca sexta diuretic hormone Mas-DH.

Authors:  M E Digan; D N Roberts; F E Enderlin; A R Woodworth; S J Kramer
Journal:  Proc Natl Acad Sci U S A       Date:  1992-11-15       Impact factor: 11.205

4.  A comparative study of leucokinin-immunoreactive neurons in insects.

Authors:  Y Chen; J A Veenstra; N T Davis; H H Hagedorn
Journal:  Cell Tissue Res       Date:  1994-04       Impact factor: 5.249

5.  Isolation and identification of a diuretic hormone from the mealworm Tenebrio molitor.

Authors:  K Furuya; K M Schegg; H Wang; D S King; D A Schooley
Journal:  Proc Natl Acad Sci U S A       Date:  1995-12-19       Impact factor: 11.205

6.  Transcriptome analysis of the desert locust central nervous system: production and annotation of a Schistocerca gregaria EST database.

Authors:  Liesbeth Badisco; Jurgen Huybrechts; Gert Simonet; Heleen Verlinden; Elisabeth Marchal; Roger Huybrechts; Liliane Schoofs; Arnold De Loof; Jozef Vanden Broeck
Journal:  PLoS One       Date:  2011-03-21       Impact factor: 3.240

7.  CRF-like diuretic hormone negatively affects both feeding and reproduction in the desert locust, Schistocerca gregaria.

Authors:  Pieter Van Wielendaele; Senne Dillen; Elisabeth Marchal; Liesbeth Badisco; Jozef Vanden Broeck
Journal:  PLoS One       Date:  2012-02-20       Impact factor: 3.240

8.  The contribution of the genomes of a termite and a locust to our understanding of insect neuropeptides and neurohormones.

Authors:  Jan A Veenstra
Journal:  Front Physiol       Date:  2014-11-19       Impact factor: 4.566
  8 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.