| Literature DB >> 12668203 |
Ren Lai1, Hen Liu, Wen Hui Lee, Yun Zhang.
Abstract
A novel 28-amino acid peptide, termed bombinakinin-GAP, was purified and characterized from skin secretions of the toad Bombina maxima. Its primary structure was established as DMYEIKQYKTAHGRPPICAPGEQCPIWV-NH(2), in which two cysteines form a disulfide bond. A FASTA search of SWISS-PROT databank detected a 32% sequence identity between the sequences of the peptide and a segment of rat cocaine- and amphetamine-regulated transcript (CART). Intracerebroventricular (i.c.v.) administration of the peptide induced a significant decrease in food intake in rats, suggesting that it played a role in the control of feeding by brain. Analysis of its cDNA structure revealed that this peptide is coexpressed with bombinakinin M, a bradykinin-related peptide from the same toad. Bombinakinin-GAP appears to be the first example of a novel class of bioactive peptides from amphibian skin, which may be implicated in feeding behavior.Entities:
Mesh:
Substances:
Year: 2003 PMID: 12668203 DOI: 10.1016/s0196-9781(03)00027-5
Source DB: PubMed Journal: Peptides ISSN: 0196-9781 Impact factor: 3.750