Literature DB >> 11056675

Heterogeneous nuclear ribonucleoproteins C1/C2 identified as autoantigens by biochemical and mass spectrometric methods.

N H Heegaard1, M R Larsen, T Muncrief, A Wiik, P Roepstorff.   

Abstract

The antigenic specificity of an unusual antinuclear antibody pattern in three patient sera was identified after separating HeLa-cell nuclear extracts by two-dimensional (2D) gel electrophoresis and localizing the antigens by immunoblotting with patient serum. Protein spots were excised from the 2D gel and their contents were analyzed by matrix-assisted laser desorption-ionization (MALDI) or nanoelectrospray ionization time-of-flight (TOF) tandem mass spectrometry (MS) after in-gel digestion with trypsin. A database search identified the proteins as the C1 and C2 heterogeneous nuclear ribonucleoproteins. The clinical spectrum of patients with these autoantibodies includes arthritis, psoriasis, myositis, and scleroderma. None of 59 patients with rheumatoid arthritis, 19 with polymyositis, 33 with scleroderma, and 10 with psoriatic arthritis had similar antibodies. High-resolution protein-separation methods and mass-spectrometric peptide mapping in combination with database searches are powerful tools in the identification of novel autoantigen specificities.

Entities:  

Mesh:

Substances:

Year:  2000        PMID: 11056675      PMCID: PMC17817          DOI: 10.1186/ar119

Source DB:  PubMed          Journal:  Arthritis Res        ISSN: 1465-9905


Introduction

The determination of the molecular and submolecular specificity of ANAs is important for diagnosis and prognosis in clinical medicine and for understanding the molecular pathology of autoimmune disease. Different antigenic specificities of ANA are associated with different diseases and different patterns of disease manifestations. The various protein antigens associated with ANAs characteristically represent molecules that bind nucleic acids. Thus, many of the proteins that associate with RNA in the RNP complexes of the spliceosome have been found to react with some types of ANA [1]. Also, the hnRNP complex that associates with newly transcribed pre-mRNA contains proteins that have been shown to be targets of ANAs in some rheumatic diseases. The protein components of hnRNP are the most abundant nonhistone proteins of the cell nucleus and are classified roughly on the basis of their molecular masses into at least 21 protein groups (A through U). Autoantibodies to the A2, B1, and B2 proteins of hnRNP found in some patients may be markers of several overlap syndromes [2]. However, ANAs with specificity for these proteins as well as for the D protein and the I protein also appear to occur in many distinct connective-tissue diseases, although epitope specificities may differ [3,8]. Despite the discovery of the A, B, and R hnRNP ANA specificities in patients [2,9,10], antibodies against the C component of hnRNP (consisting of the C1 and C2 proteins) have to our knowledge so far been described in only one case [4]. The identification in this study was based on the colocalization of patient immunoreactivity on immunoblots of nuclear extracts with the band developed with a monoclonal anti-C1/C2 antibody. In the present study, we identify the C1/C2 specificity of circulating ANAs in three patients by high-resolution separation techniques (2D gel electrophoresis) combined with the assignment of protein identities by mass-spectrometric (MS and tandem MS) peptide mapping. This protein was also found to be the target of the ANA found in the patient described earlier [4].

Materials and methods

Reagents

Trifluoroacetic acid was from Fluka (Buchs, Switzerland), HPLC-grade water and acetonitrile from Merck (Darmstadt, Germany), sequencing-grade trypsin from Promega (Madison, WI, USA). The bicinchonic acid assay for protein was from Pierce (Rockford, IL, USA). All other chemicals were of analytical grade from Sigma Chemical Co (St Louis, MO, USA).

Cells and antibodies

HeLa-cell nuclei were obtained from 4C (Mons, Belgium). Cultured carcinoma (HEp-2)-cell slides were from Immunoconcepts, Inc (Sacramento, CA, USA). Fluorescein- and alkaline-phosphatase-labeled rabbit anti-human IgG antibodies (F0202 and D0336, respectively) were from Dako (Glostrup, Denmark). A patient serum sample previously described as containing antibodies reacting with C1/C2 hnRNP [4] was generously provided by Dr J Vencovský, Prague.

Indirect immunofluorescence

Patient sera were screened for ANAs by indirect immunofluorescence microscopy on slides of acetone-fixed HEp-2 cells using a cutoff dilution of 1:160 for the patient sera.

Preparation of HeLa-cell nuclear extracts

To establish the best conditions for extracting the antigens, the nuclear material was subjected to five different procedures: high-salt extraction using either 0.5 M NaCl or 6 M guanidinium hydrochloride in 125 mM Tris/HCl, pH 6.8 (sonicated for 3×5 s at 20 000 Hz on ice); detergent extraction in 125 mM Tris/HCl, pH 6.8, with 5% β-octyl glucoside or with 2.5% Triton X-100, using sonication as above; or extraction with 2.5% SDS for 10 min on ice after mixing. All samples were subsequently centrifuged at 16 000× for 5 min and the supernatants were then analyzed by gel electrophoresis and immunoblotting (high-salt samples after being diluted 10 times in water). Extracts were either stored at -80°C or processed immediately for 1D or 2D gel electrophoresis or for reversed-phase HPLC.

Reversed-phase HPLC

HeLa-cell nuclear extracts were separated by reversed-phase HPLC on an analytical C4 column (4.6×250 mm, 300 Å, 5 μm particle size) from Vydac (Hesperia, CA, USA) using an Äkta chromatography system (Pharmacia, Lund, Sweden). The column was eluted with a 50-min gradient of 0-70% acetonitrile in 0.1% aqueous trifluoroacetic acid at 1 ml/min with monitoring at 210 and 280 nm. Fractions of 1 ml were collected. Prior to testing for reactivity with patient sera, the collected fractions were dried down in a Savant SpeedVac (Farmingdale, NY, USA) and resolubilized in 100 μl water. Dots of 2 μl of these fractions were subsequently placed on nitrocellulose, dried, and developed with patient sera as detailed below.

One- and 2D gel electrophoresis and immunoblotting

SDS-PAGE was performed in 10% precast gels from Novex (San Diego, CA, USA). Samples were solubilized at a protein concentration of 1-2 mg/ml by boiling 20-μl aliquots for 3 min in the presence of 2.5% (w/v) SDS and 25 mM dithiothreitol in 10 mM Tris/HCl, pH8, 10% (v/v) glycerol. The sample buffer also contained 50 μg/ml Pyronin G as a marker. The electrophoresis running buffer was 25 mM Tris, 192 mM glycine, 0.1% SDS, pH8.3 (Novex), and separation took place at 120 V for 1-2 h until the marker reached 1 cm from the bottom edge of the gel. Two-dimensional electrophoresis was used to analyze crude HeLa-cell nuclear extracts and HPLC-purified sub-fractions of the extracts. Prior to isoelectric focusing, samples were solubilized at a protein concentration of approximately 1 mg/ml in 1.5% (v/v) Ampholine 3.5-9.5 (Pharmacia), 0.75% (w/v) SDS, 12 mM dithiothreitol, 2 M urea, 1% CHAPS (3- [{3-cholamidopropyl}-dimethylammonio]-1-propane sulfonate), and an aliquot of bromphenol blue. Isoelectric focusing of 17-ml samples took place in 1-mm×130-mm tube gels (4% acrylamide [C=2.7%] containing 9 M urea, 1% [w/v] CHAPS, and 0.5% [v/v] Nonidet P40). The first-dimension isoelectric focusing was performed at 400 V for 17-18 h and then at 800 V for 1 h. After the isoelectric focusing, the tube gels were extruded and placed on top of a large (13×13 cm) 11% polyacrylamide gel (C=2.7%) prepared in a Protean Cell (BioRad, Hercules, CA, USA). After equilibration for about 1 min in the presence of 500 μl transfer buffer (6.25 mM Tris/HCl, pH6.8, 10% [v/v] glycerol, 2% [w/v] SDS, 200 mM dithiothreitol, and an aliquot of bromophenol blue), the second-dimension SDS-PAGE took place at a constant 15 W/gel for 4-5 h. One- and 2D gels were either silver-stained using a modified protocol of Heukeshoven and Dernick [11], in which glutaraldehyde had been left out, or they were electroblotted for 1 h at 1 mA/cm2 onto nitrocellulose of pore size 0.2 μm in a semidry electroblotting cell, according to standard procedures. Blots were blocked with non-ionic detergent (2% Tween 20) for 5 min and developed with patient sera (diluted 1:100 unless otherwise noted) and alkaline-phosphatase-labeled anti-human IgG antibodies at 1:2000 using Nitroblue tetrazolium/5-bromo-4-chloro-3-indolyl phosphate for the color reaction as described elsewhere [12].

In-gel digestion of proteins separated by gel electrophoresis

In-gel digestion was performed as described previously [6]. The excised gel plugs were washed in 50 mM NH4HCO3/acetonitrile (60/40) and dried by vacuum centrifugation. The trypsin (sequencing grade), dissolved in 50 mM NH4HCO3 at 12 ng/μl, was added to the dry gel pieces and incubated on ice for 1 h for reswelling. The supernatant was removed, 60 μl digestion buffer was added, and the digestion was continued at 37°C for 4-18 h. The peptide mixture was analyzed directly by MALDI-MS without extraction by depositing a 0.8-μl 1:1 mixture of analyte solution in 2% trifluoroacetic acid and matrix solution (15-20 g/l α-cyano-4-hydroxycinnamic acid in 70% acetonitrile) directly on the MALDI target. In other cases, the samples were desalted and concentrated as described elsewhere [13], and for analysis by MALDI-MS, the peptides were eluted with 0.5 μl matrix solution (15-20 g/l of α-cyano-4-hydroxycinnamic acid in 70% acetonitrile) and deposited directly on the MALDI target. For tandem MS, the peptides on the column were eluted with 1.5 μl 50% methanol/49% H2O/1% formic acid directly into the nanoelectrospray needle.

Peptide-mass mapping by MALDI-MS

A Bruker REFLEX model MALDI-TOF mass spectrometer (Bruker-Franzen Analytik GmbH, Bremen, Germany) equipped with the Scout source and variable detector bias gating was used in positive-ion reflector mode for mass analysis of peptide mixtures (peptide-mass mapping). The ion acceleration voltage was 20 kV.

ESI-Q-TOF MS

Tandem MS of peptides generated by in-gel digestion was performed on a nano-ESI-Q-TOF mass spectrometer (Micromass, Manchester, UK). Ions were produced in an atmospheric pressure ionization (API)/ESI ion source at 40°C. The flow rate of the drying gas was 50 l/h. A potential of 1 kV was applied to the precoated borosilicate nanoelectrospray needles (Protana A/S, Odense, Denmark), and a stable flow rate (10-30 nl/min) was produced with a nitrogen back-pressure of 0-5 psi (0-34.5 kPa). The cone voltage was 50 V. A quadrupole analyzer was used to select the precursor ion for fragmentation in the hexapole collision cell. The collision gas was argon at a pressure of 6×10-5 mbar (6×10-3 Pa) and the collision voltage was 20-25 V. Product ions were analyzed using an orthogonal TOF analyzer. Data were processed with a Mass Lynx Windows NT-based program.

Protein identification

Protein identification by peptide-mass fingerprinting was performed by searching the peptide masses in a comprehensive non-redundant protein sequence database (NRDB; European Bioinformatics Institute, Hinxton, UK) containing approximately 420 000 protein sequences, using the database search program PepSea (Protana, Odense, Denmark). The peptide-mass maps and the protein identifications were evaluated as described in [6]. The partial amino acid sequences of the peptides generated by tandem MS together with the associated masses were used to construct the peptide sequence tags [7] that were used to identify the proteins in the NRDB.

Results

Indirect immunofluorescence on HEp-2 cells

The starting point for the investigation into the specificity of the antibodies in the present study was the observation of an unusual staining pattern in a patient serum being tested for IgG reactivity on HEp-2 cells. A strong nuclear staining pattern (titer >1280) with very even-sized, coarse speckles and no staining of nucleoli was observed (Fig. 1). This staining pattern did not resemble the well-known variably sized spliceosomal speckled pattern seen with antibodiesto Sm/U1RNP or the fine speckled pattern characteristic of SSA/SSB-antibody-positive sera. In accordance with this, the patient had none of these antibody specificities when tested by specific assays (data not shown).
Figure 1

Indirect immunofluorescence pattern of anti-C1/C2-positive patient serum on HEp-2 cells. Cells were incubated with diluted patient serum (1:160), and bound IgG was detected by fluorescence microscopy after incubation with fluoresceinylated rabbit anti-human IgG. Strongly positive, very regular, coarse nuclear staining that spares nucleoli is observed. Original magnification is 200×. Scale bar is 10 μm.

Determination of antigen molecular mass in HeLa-cell nuclear extracts

The IgG reactivity of the serum shown in Fig. 1 was tested on an SDS-PAGE-separated nuclear extract from HeLa cells as shown in Fig. 2. A double band in the Mr 40 000-42 000 range and a high-molecular-mass band (around 200 000) were observed as the sole reactivities of this particular patient (Fig. 2, lane 2). Sera from two other patients, with a similar atypical ANA-staining pattern, also stained components of this doublet in immunoblotting (Fig. 2, lanes 3 and 4). The reactivity strongly resembled that of the patient originally described by Stanek et al [4] (Fig. 2, lane 5). The two different, more weakly reacting, sera appear to react preferentially with either the lower (lane 3) or the higher (lane 4) band, respectively. There was no reactivity with a normal serum (lane 1, Fig. 2). The antigens were present both in high-salt, SDS, and non-ionic detergent extracts of nuclei but appeared to be extracted to the highest degree in the β-octyl glucoside extracts (data not shown).
Figure 2

Immunoblotting using different patient sera (2-5) and a normal control serum (1) diluted 1:100 on blots of HeLa-cell nuclear extracts separated on SDS-PAGE. The serum examined in lane 2 is identical to the one shown in Fig. 1, and the serum in lane 5 is a sample from the original patient described by Stanek et al [4]. Developed with anti-IgG antibodies. Molecular masses (×10-3) of standard proteins are indicated on the left.

Enrichment of antigen preparation

After verification by immunoblotting that antibody reactivity was present in crude HeLa-cell nuclear extracts obtained by treatment with β-octyl glucoside (Fig. 2), the antigen was enriched by fractionating the extract by reversed-phase HPLC on a C4 column. Two of the collected fractions contained material with a molecular mass around 40 000 that was reactive with the patient antibody as judged by SDS-PAGE immunoblotting (data not shown).

Micropreparative separation of antigens

The contents of the crude nuclear extract obtained after β-octyl glucoside treatment were separated by 2D gel electrophoresis into several hundred components (Fig. 3a). However, the patient antibodies only reacted with two components in the mixture on immunoblots of the 2D separation (Fig. 3b). The two components appeared to be of approximately the same isoelectric points, but they differed in molecular mass by approximately 2000. The purified fractions from the C4 reversed-phase HPLC separation gave a less complicated 2D separation pattern (Fig. 3c), in which the two reactive spots (encircled) could be clearly identified and were positive on immunoblotting with patient serum (Fig. 3d). These two spots were excised for individual characterization.
Figure 3

Isolation of antibody-reactive proteins by 2D gel electrophoresis and immunoblotting. (a) Two-dimensional gel electrophoresis of HeLa-cell nuclear extract. Molecular-weight marker positions are indicated on the left. Isoelectric focusing was in the horizontal dimension with the anode on the left. The gel is silver-stained. (b) Immunoblot from a separation similar to the one shown in (a), developed with the patient serum diluted 1:200. (c) Two-dimensional electrophoresis of a fraction of the nuclear extract purified by reversed-phase HPLC. (d) The immunoblot of the separation in (c), developed with a 1:200 dilution of patient serum. The two prominent spots marked with a circle in (c) were cut out separately and analyzed by MS after in-gel trypsin digestion.

MALDI-TOF peptide-mass mapping was performed on the tryptic peptide mixture generated by in-gel digestion of the two components after excision from 2D gels in two independent experiments. The database search compared the detected peptide masses with the theoretical tryptic peptide masses of the protein sequences present in the database. This approach in both sets of experiments suggested that the two proteins were hnRNPs C1/C2 (Swissprot accession number P07910), a conclusion suggested by the matching of 8 of 27 peptide masses entered (data not shown). The low number of matched peptides relative to the number of peptides included in the search, together with the small difference in the number of matching peptides to the next hit in the database (three peptides), make this identification only tentative. Therefore, the identity of the proteins was further confirmed by tandem MS using an ESI-Q-TOF instrument. One peptide carrying two positive charges (m/z 580.32 Da) corresponding to a peptide mass of 1158.7 Da was selected as a precursor ion and fragmented in the collision cell. The fragment ion spectrum is illustrated in Fig. 4a. A peptide sequence tag [7] consisting of a partial sequence and its associated masses was constructed -(632.36)LLSD(1060.70) - and was used to search the NRDB. The database search subsequently unambiguously identified the protein as human C1/C2 hnRNP (data not shown). The fragmented peptide was found to represent the tryptic fragment VDSLLENLEK, ie amino acids 207-216 (C2 protein numbering). Four other peptides were partially sequenced, and all were found to match the human C1/C2 hnRNP sequence (data not shown). Several of the peptide masses that were not matched to the sequence could be matched to peptides derived from keratin and from autoproteolysis of trypsin (data not shown).
Figure 4

Identification of C1/C2 hnRNPs by MS and by tandem MS sequencing. (a) Collision-induced dissociation spectrum of a doubly charged ion at m/z 580.32 Da corresponding to the sequence 207-216 (VDSLLENLEK) of the C2 hnRNP. The Y ion signal series is shown together with the deduced sequence giving the peptide sequence tag (632.36)LLSD(1060.70). (b) Two sections of the MALDI-MS peptide-mass maps showing the difference between the upper (C2) hnRNP and the lower (C1) hnRNP spots excised from 2D gels (cf Fig. 3c). The signal at m/z 3433.6 Da detected in the trypsin-digested material from the upper spot could be identified as the tryptic peptide that includes the 13-amino-acid insert in C2 hnRNP (illustrated in the figure). Only the corresponding peptide without the insert could be detected (at m/z 2101.9 Da) in the peptide-mass map from the lower spot. Signals derived by autoproteolysis of trypsin are marked with stars.

The theoretical masses of C1 and C2 are 32.0 and 33.3 kDa, respectively. The difference between the two sequences is a 13-amino-acid insert in C2 between positions 107 and 108 of C1. The presence of a specific tryptic fragment in the MALDI-TOF peptide-mass map from the upper spot but not from the lower spot containing a 13-amino-acid insert in the protein sequence (SAAEMYGSVT-EHPSPSPLLSSSFDLDYDFQR) clearly demonstrates that the two components in the gel represent the two isoforms of the C-class of hnRNPS (Fig. 4b). The peptide-mass map of C1 contains a peptide signal at m/z 2101.9 Da, corresponding to the tryptic peptide without the 13-amino-acid insert - SAAEMYGSSFDLDYDFQR.

Patients and clinical data

The patient whose case prompted us to investigate the specificities of these antibodies was a 72-year-old man with a speckled ANA titer of >1280, who had arthralgias and oligoarthritis but did not fulfill the criteria for rheumatoid arthritis and did not have dermatological complaints. The reactivity of sera from various patient groups towards the C1/C2 hnRNP autoantigens was subsequently tested by immunoblotting of HeLa-cell nuclear extracts. None of 59 patients with rheumatoid arthritis, 19 with polymyositis, 33 with scleroderma, and 10 with psoriatic arthritis had IgG antibodies reacting with the two bands. Among 139 consecutive patients who had moderately to strongly positive speckled ANA patterns by indirect immunofluorescence on HEp-2 cells, only two additional patients had sera that reacted with the C1/C2 hnRNP bands in immunoblotting (Fig. 2, lanes 3 and 4). The serum of one of these patients reacted preferentially with the C1 hnRNP, and that of the other reacted with the C2 hnRNP and thus may be specific for the C2 insert. One patient was a young woman (22 years old) with complaints of muscle tenderness but without objective findings or other abnormal laboratory test findings, whose sera showed speckled ANAs, with a titer of >1280. A third patient whose case we identified through ANA screening followed by immunoblotting was a 54-year-old man, whose sera also showed speckled ANAs, with a titer of >1280. This man was receiving methotrexate and had long-standing polymyositis in addition to psoriasis and possible osteoporosis.

Discussion

Although the prototype serum found in our study strongly matched the reactivity of the serum from the report by Stanek et al [4] with respect to the singular staining pattern shown in Fig. 1, it probably would not be recognized as such in routine diagnostic laboratory tests. The present study confirms the existence of anti-C1/C2 antibodies in some patients with speckled ANAs. The antigens were identified through the use of biochemical methods using high-resolution separation techniques combined with mass-spectrometry peptide mapping and database searches. As a general approach, this is a powerful way to identify new antigens using small amounts of material without the need for conventional protein sequencing and consequently with no problems related to blocked N-termini. The approach does require, however, that the proteins can be found in databases, that they are not extensively post-translationally modified, that they can be digested enzymatically, and that they can be isolated in appropriately pure form by the separation technique used. The C1 and C2 proteins are identical except for an insert of 13 amino acids after serine 107 in the 303-amino-acid-containing C2 protein [14,15]. The presence of this insert accounts for the separation of the C1 and C2 proteins by SDS-PAGE. Like other hnRNPs, they contain consensus sequence RNA-binding domains and nuclear localization signals [15]. The C1/C2 proteins form anisotropic([C1]3 [C2]1) tetramers that bind strongly but apparentlynonspecifically to RNA and probably form a basic structural unit in pre-mRNA-processing and RNA-packaging complexes [14,16,17,18]. Together with the A and B groups of hnRNPs, they constitute the core proteins of the 40S hnRNP particles [19]. C1 and C2 are phosphorylated, contain unusually acidic C-terminal domains, and, accordingly, are the most acidic of the hnRNPs. It is not known at present if the C1/C2 antibodies are pathogenically relevant and/or relate to specific diagnoses or subsets within the group of connective-tissue diseases. Although ELISA with native antigen may increase the number of positive findings, reactivity does seem to be quite rare among ANA-positive patients. Therefore, clarification of these issues would require the study of many patients. Autoantibodies to many of the core proteins of the hnRNP complex have now been described, including the A1, A2/RA33, A3, B1, and B2 proteins as well as D/AUF-1 and, recently, also the hnRNP R protein [2,3,9,10]. These proteins are primarily involved in packaging and processing of pre-mRNA and in the regulation of alternative splicing. They may also be involved in RNA transport between the nucleus and the cytoplasm. ANAs directed against these proteins do not give clear-cut ANA reactivity on commonly used ANA substrates such as HEp-2 cells [20,21]. This is probably because the antibodies specifically target RNA-binding domains that are shielded by bound RNA in intact cells. The fact that these antibodies often appear together with other ANAs in systemic lupus erythematosus, in mixed connective-tissue diseases, and in adult and juvenile rheumatoid arthritis has made it difficult to study their presence except by immunoblotting of extracts treated with DNase and RNase to remove nucleic acids. The fact that antibodies to the C1/C2 hnRNPs are revealed by indirect immunofluorescence indicates that the epitopes are accessible in intact, fixed HEp-2 cells and thus are probably outside nucleic-acid-binding domains that would be expected to be covered by RNA.
  18 in total

1.  Anti-A2/RA33 autoantibodies are directed to the RNA binding region of the A2 protein of the heterogeneous nuclear ribonucleoprotein complex. Differential epitope recognition in rheumatoid arthritis, systemic lupus erythematosus, and mixed connective tissue disease.

Authors:  K Skriner; W H Sommergruber; V Tremmel; I Fischer; A Barta; J S Smolen; G Steiner
Journal:  J Clin Invest       Date:  1997-07-01       Impact factor: 14.808

2.  Demonstration of a new antinuclear antibody (anti-RA33) that is highly specific for rheumatoid arthritis.

Authors:  W Hassfeld; G Steiner; K Hartmuth; G Kolarz; O Scherak; W Graninger; N Thumb; J S Smolen
Journal:  Arthritis Rheum       Date:  1989-12

3.  Primary structure differences between proteins C1 and C2 of HeLa 40S nuclear ribonucleoprotein particles.

Authors:  B M Merrill; S F Barnett; W M LeStourgeon; K R Williams
Journal:  Nucleic Acids Res       Date:  1989-11-11       Impact factor: 16.971

4.  Error-tolerant identification of peptides in sequence databases by peptide sequence tags.

Authors:  M Mann; M Wilm
Journal:  Anal Chem       Date:  1994-12-15       Impact factor: 6.986

5.  Heterogenous nuclear RNP C1 and C2 core proteins are targets for an autoantibody found in the serum of a patient with systemic sclerosis and psoriatic arthritis.

Authors:  D Stanek; J Vencovský; J Kafková; I Raska
Journal:  Arthritis Rheum       Date:  1997-12

6.  Molecular definition of heterogeneous nuclear ribonucleoprotein R (hnRNP R) using autoimmune antibody: immunological relationship with hnRNP P.

Authors:  W Hassfeld; E K Chan; D A Mathison; D Portman; G Dreyfuss; G Steiner; E M Tan
Journal:  Nucleic Acids Res       Date:  1998-01-15       Impact factor: 16.971

Review 7.  Autoantibodies to the A/B proteins of the heterogeneous nuclear ribonucleoprotein complex: novel tools for the diagnosis of rheumatic diseases.

Authors:  G Steiner; K Skriner; J S Smolen
Journal:  Int Arch Allergy Immunol       Date:  1996-12       Impact factor: 2.749

8.  Identification of autoantibodies to the I protein of the heterogeneous nuclear ribonucleoprotein complex in patients with systemic sclerosis.

Authors:  C Montecucco; R Caporali; F Cobianchi; G Biamonti
Journal:  Arthritis Rheum       Date:  1996-10

9.  Autoimmune response to the spliceosome. An immunologic link between rheumatoid arthritis, mixed connective tissue disease, and systemic lupus erythematosus.

Authors:  W Hassfeld; G Steiner; A Studnicka-Benke; K Skriner; W Graninger; I Fischer; J S Smolen
Journal:  Arthritis Rheum       Date:  1995-06

10.  Interaction of the RNA-binding domain of the hnRNP C proteins with RNA.

Authors:  M Görlach; M Wittekind; R A Beckman; L Mueller; G Dreyfuss
Journal:  EMBO J       Date:  1992-09       Impact factor: 11.598

View more
  5 in total

1.  Protein disulfide isomerases are antibody targets during immune-mediated tumor destruction.

Authors:  Catia Fonseca; Robert Soiffer; Vincent Ho; Matthew Vanneman; Masahisa Jinushi; Jerome Ritz; Donna Neuberg; Richard Stone; Dan DeAngelo; Glenn Dranoff
Journal:  Blood       Date:  2008-11-13       Impact factor: 22.113

2.  An Autoantigen Profile of Human A549 Lung Cells Reveals Viral and Host Etiologic Molecular Attributes of Autoimmunity in COVID-19.

Authors:  Julia Y Wang; Wei Zhang; Michael W Roehrl; Victor B Roehrl; Michael H Roehrl
Journal:  bioRxiv       Date:  2021-02-22

3.  An Autoantigen Atlas From Human Lung HFL1 Cells Offers Clues to Neurological and Diverse Autoimmune Manifestations of COVID-19.

Authors:  Julia Y Wang; Wei Zhang; Victor B Roehrl; Michael W Roehrl; Michael H Roehrl
Journal:  Front Immunol       Date:  2022-03-24       Impact factor: 8.786

4.  ADAR and hnRNPC deficiency synergize in activating endogenous dsRNA-induced type I IFN responses.

Authors:  Anna-Maria Herzner; Zia Khan; Eric L Van Nostrand; Sara Chan; Trinna Cuellar; Ronald Chen; Ximo Pechuan-Jorge; Laszlo Komuves; Margaret Solon; Zora Modrusan; Benjamin Haley; Gene W Yeo; Timothy W Behrens; Matthew L Albert
Journal:  J Exp Med       Date:  2021-07-23       Impact factor: 14.307

5.  A Master Autoantigen-ome Links Alternative Splicing, Female Predilection, and COVID-19 to Autoimmune Diseases.

Authors:  Julia Y Wang; Michael W Roehrl; Victor B Roehrl; Michael H Roehrl
Journal:  bioRxiv       Date:  2021-08-04
  5 in total

北京卡尤迪生物科技股份有限公司 © 2022-2023.